StarFunc result for job id Q9P246

User Input

>input (746 residues)
MLVLGLLVAGAADGCELVPRHLRGRRATGSAATAASSPAAAAGDSPALMTDPCMSLSPPC
FTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHIT
IEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMI
SQLKISDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFILTVSIVIGVGGCWFAYTQNKT
SKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRNVAVEKQNLERKMMDEINYAKEE
ACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFELRSSWSVPDALQKWLQLTHE
VEVQYYNIKRQNAEMQLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKAL
SELTTCLRERLFRWQQIEKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRVSIPPYPIAGG
VDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSH
PRHPHHPQHTPHSLPSPDPDILSVSSCPALYRNEEEEEAIYFSAEKQWEVPDTASECDSL
NSSIGRKQSPPLSLEIYQTLSPRKISRDEVSLEDSSRGDSPVTVDVSWGSPDCVGLTETK
SMIFSPASKVYNGILEKSCSMNQLSSGIPVPKPRHTSCSSAGNDSKPVQEAPSVARISSI
PHDLCHNGEKSKKPSKIKSLFKKKSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A5X1	0.717	0.720	8.522E-85	743	0.938	0.942	D4A5X1.pdb.gz	D4A5X1_RAT Stromal interaction molecule 2 OS=Rattus norvegicus OX=10116 GN=Stim2 PE=1 SV=3
2	AFDB:G0XQ39	0.269	0.256	6.236E-42	791	0.454	0.429	G0XQ39.pdb.gz	G0XQ39_HUMAN STIM1L OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=1
3	AFDB:H0YDB2	0.291	0.302	1.888E-41	716	0.440	0.458	H0YDB2.pdb.gz	H0YDB2_HUMAN Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=2
4	AFDB:P70302	0.242	0.261	2.825E-41	685	0.430	0.469	P70302.pdb.gz	STIM1_MOUSE Stromal interaction molecule 1 OS=Mus musculus OX=10090 GN=Stim1 PE=1 SV=2
5	AFDB:A0A2R8RIM0	0.272	0.287	4.285E-40	703	0.426	0.452	A0A2R8RIM0.pdb.gz	A0A2R8RIM0_DANRE Stromal interaction molecule 1 isoform X3 OS=Danio rerio OX=7955 GN=si:dkey-24p1.5 PE=1 SV=1
6	AFDB:Q8MMD3	0.156	0.112	6.609E-5	1106	0.168	0.113	Q8MMD3.pdb.gz	Q8MMD3_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform C OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
7	AFDB:Q8MMD2	0.161	0.106	2.847E-4	1232	0.153	0.093	Q8MMD2.pdb.gz	Q8MMD2_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform B OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
8	AFDB:Q8WQ61	0.109	0.076	3.851E-4	1253	0.162	0.097	Q8WQ61.pdb.gz	Q8WQ61_DROME Eps-15 protein OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=2 SV=1
9	AFDB:O75334	0.117	0.080	2.134E-3	1257	0.141	0.084	O75334.pdb.gz	LIPA2_HUMAN Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=PPFIA2 PE=1 SV=2
10	AFDB:Q60902	0.083	0.069	2.360E-3	907	0.146	0.120	Q60902.pdb.gz	EP15R_MOUSE Epidermal growth factor receptor substrate 15-like 1 OS=Mus musculus OX=10090 GN=Eps15l1 PE=1 SV=3
11	PDB:2lhiA	0.111	0.361	1.177E-1	176	0.025	0.108	2lhiA.pdb.gz	Solution structures of yeast Saccharomyces cerevisiae calmodulin in calcium- and target peptide-bound states reveal similarities and differences to vertebrate calmodulin.
12	PDB:4gwpA	0.091	0.416	2.915E-1	112	0.028	0.188	4gwpA.pdb.gz
13	PDB:1s1eA	0.091	0.302	5.334E-1	181	0.023	0.094	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
14	PDB:4e53A	0.084	0.333	5.609E-1	168	0.023	0.101	4e53A.pdb.gz
15	PDB:7anwA	0.083	0.095	6.524E-1	645	0.032	0.037	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
16	PDB:3nr1A	0.054	0.170	8.392E-1	178	0.029	0.124	3nr1A.pdb.gz	A metazoan ortholog of SpoT hydrolyzes ppGpp and functions in starvation responses
17	PDB:5x9aB	0.081	0.253	8.825E-1	198	0.029	0.111	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition
18	PDB:7rroI4	0.081	0.264	9.281E-1	187	0.025	0.102	7rroI4.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:2ct9B	0.085	0.280	1.026	198	0.020	0.076	2ct9B.pdb.gz	Structural characterization of calcineurin B homologous protein 1
20	PDB:2n6aA	0.111	0.363	1.026	162	0.019	0.086	2n6aA.pdb.gz	An investigation of calcium mediate signaling by the Connexin 36 gap junction protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A6S4	0.0	1326	817	0.934	0.853	A0A8I6A6S4_RAT Stromal interaction molecule 2 OS=Rattus norvegicus OX=10116 GN=Stim2 PE=1 SV=1
2	A0A8I6AK33	0.0	1295	714	0.885	0.924	A0A8I6AK33_RAT Stromal interaction molecule 2 OS=Rattus norvegicus OX=10116 GN=Stim2 PE=1 SV=1
3	D4A5X1	0.0	1332	809	0.934	0.862	D4A5X1_RAT Stromal interaction molecule 2 OS=Rattus norvegicus OX=10116 GN=Stim2 PE=1 SV=3
4	G0XQ39	0.0	580	791	0.387	0.365	G0XQ39_HUMAN STIM1L OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=1
5	H0YDB2	0.0	579	716	0.391	0.408	H0YDB2_HUMAN Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=2
6	P70302	0.0	579	685	0.401	0.436	STIM1_MOUSE Stromal interaction molecule 1 OS=Mus musculus OX=10090 GN=Stim1 PE=1 SV=2
7	P83093	0.0	1331	746	0.936	0.936	STIM2_MOUSE Stromal interaction molecule 2 OS=Mus musculus OX=10090 GN=Stim2 PE=1 SV=2
8	P84903	0.0	579	685	0.397	0.432	STIM1_RAT Stromal interaction molecule 1 OS=Rattus norvegicus OX=10116 GN=Stim1 PE=1 SV=1
9	Q13586	0.0	584	685	0.399	0.435	STIM1_HUMAN Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3
10	Q9P246	0.0	1544	746	1.000	1.000	STIM2_HUMAN Stromal interaction molecule 2 OS=Homo sapiens OX=9606 GN=STIM2 PE=1 SV=2
11	Q1LY88	4.51e-176	522	676	0.351	0.388	Q1LY88_DANRE Stromal interaction molecule 1 precursor OS=Danio rerio OX=7955 GN=si:dkey-24p1.5 PE=1 SV=1
12	A0A2R8RIM0	2.93e-175	521	703	0.351	0.373	A0A2R8RIM0_DANRE Stromal interaction molecule 1 isoform X3 OS=Danio rerio OX=7955 GN=si:dkey-24p1.5 PE=1 SV=1
13	E9PNJ4	1.38e-142	430	512	0.303	0.441	E9PNJ4_HUMAN Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=1
14	P83094	3.75e-104	332	570	0.247	0.323	STIM_DROME Stromal interaction molecule homolog OS=Drosophila melanogaster OX=7227 GN=Stim PE=1 SV=1
15	G5EF60	5.25e-43	166	530	0.160	0.225	STIM1_CAEEL Stromal interaction molecule 1 OS=Caenorhabditis elegans OX=6239 GN=stim-1 PE=1 SV=1
16	M9PC48	1.62e-04	47.8	18095	0.080	0.003	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PCJ6	1.69e-04	47.8	18641	0.080	0.003	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PB30	4.41e-04	46.6	22949	0.080	0.003	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
19	M9PC41	4.41e-04	46.6	22743	0.080	0.003	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PC45	4.45e-04	46.6	22300	0.080	0.003	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20212 DUF6572	2.1e+02	13.6	Family of unknown function (DUF6572)
2	PF00536 SAM_1	0.025	26.3	SAM domain (Sterile alpha motif)
3	PF07647 SAM_2	2.4e-10	51.7	SAM domain (Sterile alpha motif)
4	PF09235 SAM_Ste50p	1.8e+02	13.8	Ste50p, sterile alpha motif
5	PF16533 SOAR	6.4e-40	146.5	STIM1 Orai1-activating region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417569

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480616	0.998	Calcium release-activated calcium channel protein 1
2	9606.ENSP00000322249	0.994	Protein orai-3
3	9606.ENSP00000348752	0.994	Protein orai-2
4	9606.ENSP00000419313	0.784	Short transient receptor potential channel 1
5	9606.ENSP00000306253	0.778	Inositol 1,4,5-trisphosphate receptor type 1
6	9606.ENSP00000363435	0.765	Inositol 1,4,5-trisphosphate receptor type 3
7	9606.ENSP00000340913	0.745	Short transient receptor potential channel 6
8	9606.ENSP00000233121	0.744	Microtubule-associated protein RP/EB family member 3
9	9606.ENSP00000254101	0.743	5'-AMP-activated protein kinase subunit beta-2
10	9606.ENSP00000247461	0.733	Calnexin
11	9606.ENSP00000368966	0.715	Short transient receptor potential channel 3
12	9606.ENSP00000360290	0.713	5'-AMP-activated protein kinase catalytic subunit alpha-2
13	9606.ENSP00000353072	0.706	Sarcoplasmic/endoplasmic reticulum calcium ATPase 3
14	9606.ENSP00000286424	0.685	Transmembrane BAX inhibitor motif containing 4
15	9606.ENSP00000346148	0.685	5'-AMP-activated protein kinase catalytic subunit alpha-1
16	9606.ENSP00000287878	0.683	5'-AMP-activated protein kinase subunit gamma-2
17	9606.ENSP00000267113	0.682	Extended synaptotagmin-1
18	9606.ENSP00000295589	0.671	Cholecystokinin receptor type A
19	9606.ENSP00000370744	0.670	Inositol 1,4,5-trisphosphate receptor type 2
20	9606.ENSP00000322218	0.666	Membrane-associated phosphatidylinositol transfer protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005246	0.999	calcium channel regulator activity
GO:0015318	0.509	inorganic molecular entity transmembrane transporter activity
GO:0008324	0.497	monoatomic cation transmembrane transporter activity
GO:0042802	0.488	identical protein binding
GO:1901702	0.476	salt transmembrane transporter activity
GO:0046873	0.476	metal ion transmembrane transporter activity
GO:0043167	0.428	ion binding
GO:0015085	0.394	calcium ion transmembrane transporter activity
GO:0015267	0.361	channel activity
GO:0005216	0.326	monoatomic ion channel activity
GO:0005261	0.305	monoatomic cation channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0051050	0.984	positive regulation of transport
GO:0048522	0.977	positive regulation of cellular process
GO:0032412	0.976	regulation of monoatomic ion transmembrane transporter activity
GO:1904062	0.975	regulation of monoatomic cation transmembrane transport
GO:1901021	0.968	positive regulation of calcium ion transmembrane transporter activity
GO:2001259	0.957	positive regulation of cation channel activity
GO:0009987	0.738	cellular process
GO:0051179	0.592	localization
GO:0050896	0.493	response to stimulus
GO:0006810	0.451	transport
GO:0006816	0.378	calcium ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.998	endomembrane system
GO:0043227	0.996	membrane-bounded organelle
GO:0005737	0.996	cytoplasm
GO:0043229	0.996	intracellular organelle
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005783	0.913	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.394	Ca(2+)(in) = Ca(2+)(out)

[back to server]