StarFunc result for job id Q9P253

User Input

>input (973 residues)
MASILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSL
VVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKVHKMFLDHTGSHLLIALSSTE
VLYVNRNGQKVRPLARWKGQLVESVGWNKALGTESSTGPILVGTAQGHIFEAELSASEGG
LFGPAPDLYFRPLYVLNEEGGPAPVCSLEAERGPDGRSFVIATTRQRLFQFIGRAAEGAE
AQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGALDCG
RPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVLRDHFL
EKFGPLKHMVKDSSTGQLWAYTERAVFRYHVQREARDVWRTYLDMNRFDLAKEYCRERPD
CLDTVLAREADFCFRQRRYLESARCYALTQSYFEEIALKFLEARQEEALAEFLQRKLASL
KPAERTQATLLTTWLTELYLSRLGALQGDPEALTLYRETKECFRTFLSSPRHKEWLFASR
ASIHELLASHGDTEHMVYFAVIMQDYERVVAYHCQHEAYEEALAVLARHRDPQLFYKFSP
ILIRHIPRQLVDAWIEMGSRLDARQLIPALVNYSQGGEVQQVSQAIRYMEFCVNVLGETE
QAIHNYLLSLYARGRPDSLLAYLEQAGASPHRVHYDLKYALRLCAEHGHHRACVHVYKVL
ELYEEAVDLALQVDVDLAKQCADLPEEDEELRKKLWLKIARHVVQEEEDVQTAMACLASC
PLLKIEDVLPFFPDFVTIDHFKEAICSSLKAYNHHIQELQREMEEATASAQRIRRDLQEL
RGRYGTVEPQDKCATCDFPLLNRPFYLFLCGHMFHADCLLQAVRPGLPAYKQARLEELQR
KLGAAPPPAKGSARAKEAEGGAATAGPSREQLKADLDELVAAECVYCGELMIRSIDRPFI
DPQRYEEEQLSWL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5DFJ4	0.724	0.724	0.000	973	0.951	0.951	B5DFJ4.pdb.gz	B5DFJ4_RAT Vacuolar protein sorting-associated protein 18 homolog OS=Rattus norvegicus OX=10116 GN=Vps18 PE=1 SV=1
2	AFDB:P59015	0.798	0.797	0.000	974	0.659	0.658	P59015.pdb.gz	VPS18_DANRE Vacuolar protein sorting-associated protein 18 homolog OS=Danio rerio OX=7955 GN=vps18 PE=2 SV=2
3	AFDB:Q24314	0.696	0.679	1.614E-70	1002	0.355	0.344	Q24314.pdb.gz	VPS18_DROME Vacuolar protein sorting-associated protein 18 homolog OS=Drosophila melanogaster OX=7227 GN=dor PE=1 SV=3
4	AFDB:F4IDS7	0.605	0.597	1.721E-66	988	0.331	0.326	F4IDS7.pdb.gz	VPS18_ARATH Vacuolar sorting protein 18 OS=Arabidopsis thaliana OX=3702 GN=VPS18 PE=1 SV=1
5	AFDB:G5EAW8	0.684	0.690	2.830E-65	963	0.308	0.312	G5EAW8.pdb.gz	G5EAW8_EMENI Pep3/Vps18/deep orange domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=digA PE=3 SV=1
6	AFDB:Q23194	0.592	0.567	5.204E-57	1026	0.253	0.240	Q23194.pdb.gz	VPS18_CAEEL Vacuolar protein sorting-associated protein 18 homolog OS=Caenorhabditis elegans OX=6239 GN=vps-18 PE=1 SV=4
7	AFDB:O74925	0.622	0.667	8.261E-50	900	0.230	0.249	O74925.pdb.gz	PEP3_SCHPO Vacuolar membrane protein pep3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pep3 PE=3 SV=1
8	AFDB:P27801	0.545	0.573	1.489E-45	918	0.210	0.222	P27801.pdb.gz	PEP3_YEAST Vacuolar membrane protein PEP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEP3 PE=1 SV=1
9	AFDB:Q9P6N4	0.401	0.424	4.918E-25	906	0.134	0.143	Q9P6N4.pdb.gz	PEP5_SCHPO E3 ubiquitin-protein ligase pep5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps11 PE=3 SV=1
10	AFDB:Q19954	0.275	0.295	1.035E-24	901	0.129	0.140	Q19954.pdb.gz	VPS41_CAEEL Vacuolar protein sorting-associated protein 41 homolog OS=Caenorhabditis elegans OX=6239 GN=vps-41 PE=3 SV=4
11	PDB:7zu0C	0.433	0.487	3.554E-22	842	0.145	0.167	7zu0C.pdb.gz
12	PDB:7zu0A	0.412	0.419	3.642E-15	954	0.124	0.127	7zu0A.pdb.gz
13	PDB:1xi4A	0.268	0.172	4.735E-15	1630	0.095	0.056	1xi4A.pdb.gz
14	PDB:7mq8LR	0.243	0.297	7.164E-11	773	0.069	0.087	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:5lcwR	0.248	0.569	1.211E-10	383	0.051	0.131	5lcwR.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
16	PDB:7qpgR	0.250	0.126	1.718E-10	2208	0.137	0.060	7qpgR.pdb.gz
17	PDB:6zonI	0.247	0.687	3.312E-10	305	0.048	0.154	6zonI.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
18	PDB:7emfP	0.236	0.288	3.460E-10	766	0.098	0.124	7emfP.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
19	PDB:6qk7A	0.154	0.134	4.700E-10	1161	0.121	0.102	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
20	PDB:7r5jD4	0.246	0.191	5.130E-10	1312	0.124	0.092	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5DFJ4	0.0	1867	973	0.952	0.952	B5DFJ4_RAT Vacuolar protein sorting-associated protein 18 homolog OS=Rattus norvegicus OX=10116 GN=Vps18 PE=1 SV=1
2	P59015	0.0	1402	974	0.660	0.659	VPS18_DANRE Vacuolar protein sorting-associated protein 18 homolog OS=Danio rerio OX=7955 GN=vps18 PE=2 SV=2
3	Q8R307	0.0	1875	973	0.958	0.958	VPS18_MOUSE Vacuolar protein sorting-associated protein 18 homolog OS=Mus musculus OX=10090 GN=Vps18 PE=1 SV=2
4	Q9P253	0.0	2002	973	1.000	1.000	VPS18_HUMAN Vacuolar protein sorting-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=VPS18 PE=1 SV=2
5	Q24314	2.17e-172	531	1002	0.350	0.340	VPS18_DROME Vacuolar protein sorting-associated protein 18 homolog OS=Drosophila melanogaster OX=7227 GN=dor PE=1 SV=3
6	F4IDS7	7.24e-162	503	988	0.334	0.329	VPS18_ARATH Vacuolar sorting protein 18 OS=Arabidopsis thaliana OX=3702 GN=VPS18 PE=1 SV=1
7	G5EAW8	1.45e-148	467	963	0.319	0.322	G5EAW8_EMENI Pep3/Vps18/deep orange domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=digA PE=3 SV=1
8	Q23194	1.17e-95	327	1026	0.273	0.259	VPS18_CAEEL Vacuolar protein sorting-associated protein 18 homolog OS=Caenorhabditis elegans OX=6239 GN=vps-18 PE=1 SV=4
9	O74925	5.50e-92	314	900	0.240	0.260	PEP3_SCHPO Vacuolar membrane protein pep3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pep3 PE=3 SV=1
10	P27801	9.53e-53	202	918	0.180	0.191	PEP3_YEAST Vacuolar membrane protein PEP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEP3 PE=1 SV=1
11	Q658K0	4.84e-08	59.7	940	0.092	0.096	Q658K0_HUMAN Vacuolar protein sorting-associated protein 11 homolog OS=Homo sapiens OX=9606 GN=DKFZp564P2364 PE=2 SV=1
12	Q53FX3	1.36e-07	58.2	941	0.092	0.096	Q53FX3_HUMAN Vacuolar protein sorting 11 (Yeast homolog) variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
13	Q9H270	1.63e-07	57.8	941	0.092	0.096	VPS11_HUMAN Vacuolar protein sorting-associated protein 11 homolog OS=Homo sapiens OX=9606 GN=VPS11 PE=1 SV=1
14	Q91W86	9.11e-06	52.4	941	0.049	0.051	VPS11_MOUSE Vacuolar protein sorting-associated protein 11 homolog OS=Mus musculus OX=10090 GN=Vps11 PE=1 SV=3
15	Q9SJ40	1.34e-05	51.6	932	0.046	0.048	VPS11_ARATH Vacuolar protein-sorting-associated protein 11 homolog OS=Arabidopsis thaliana OX=3702 GN=VPS11 PE=1 SV=1
16	Q4G0A0	4.64e-05	50.1	927	0.098	0.102	Q4G0A0_DANRE Vacuolar protein sorting-associated protein 11 homolog OS=Danio rerio OX=7955 GN=zgc:112329 PE=1 SV=1
17	Q9P6N4	0.009	42.4	906	0.031	0.033	PEP5_SCHPO E3 ubiquitin-protein ligase pep5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps11 PE=3 SV=1
18	O14186	0.017	41.6	846	0.039	0.045	YDSB_SCHPO Uncharacterized WD repeat-containing protein C4F8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F8.11 PE=4 SV=1
19	P87295	0.022	41.2	847	0.022	0.025	PEP5L_SCHPO Pep5-like zinc finger protein C16A10.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC16A10.03c PE=4 SV=2
20	Q19954	0.031	40.8	901	0.069	0.074	VPS41_CAEEL Vacuolar protein sorting-associated protein 41 homolog OS=Caenorhabditis elegans OX=6239 GN=vps-41 PE=3 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00637 Clathrin	1e-06	40.1	Region in Clathrin and VPS
2	PF03791 KNOX2	40	15.1	KNOX2 domain
3	PF05131 Pep3_Vps18	4.2e-34	129.0	Pep3/Vps18/deep orange family
4	PF10367 Vps39_2	16	17.4	Vacuolar sorting protein 39 domain 2
5	PF12861 zf-ANAPC11	48	15.4	Anaphase-promoting complex subunit 11 RING-H2 finger
6	PF13923 zf-C3HC4_2	2.6	19.3	Zinc finger, C3HC4 type (RING finger)
7	PF12678 zf-rbx1	1.3e+02	14.3	RING-H2 zinc finger domain
8	PF17120 zf-RING_16	2.7	19.0	RING/Ubox like zinc-binding domain
9	PF13639 zf-RING_2	56	15.5	Ring finger domain
10	PF14634 zf-RING_5	4.5	18.6	zinc-RING finger domain
11	PF13445 zf-RING_UBOX	64	15.0	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220509

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267199	0.999	Vacuolar protein sorting-associated protein 33A
2	9606.ENSP00000309457	0.999	Vacuolar protein sorting-associated protein 41 homolog
3	9606.ENSP00000335193	0.999	Vam6/Vps39-like protein
4	9606.ENSP00000369810	0.999	Vacuolar protein sorting-associated protein 16 homolog
5	9606.ENSP00000377027	0.999	Transforming growth factor-beta receptor-associated protein 1
6	9606.ENSP00000481126	0.999	Vacuolar protein sorting-associated protein 11 homolog
7	9606.ENSP00000404704	0.998	Vacuolar protein sorting-associated protein 8 homolog
8	9606.ENSP00000327650	0.995	Vacuolar protein sorting-associated protein 33B
9	9606.ENSP00000265062	0.980	Ras-related protein Rab-7a
10	9606.ENSP00000376792	0.976	Vesicle transport through interaction with t-SNAREs homolog 1A
11	9606.ENSP00000450731	0.937	Vesicle transport through interaction with t-SNAREs homolog 1B
12	9606.ENSP00000259400	0.916	Syntaxin-17
13	9606.ENSP00000358126	0.915	Vacuolar protein sorting-associated protein 45
14	9606.ENSP00000479762	0.883	Ras-related protein Rab-7b
15	9606.ENSP00000356918	0.876	Syntaxin-7
16	9606.ENSP00000305255	0.872	Syntaxin-8
17	9606.ENSP00000273047	0.871	Ras-related protein Rab-5A
18	9606.ENSP00000258301	0.870	Syntaxin-6
19	9606.ENSP00000450614	0.851	annotation not available
20	9606.ENSP00000421380	0.829	Vacuolar-sorting protein SNF8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010256	0.996	endomembrane system organization
GO:0007032	0.994	endosome organization
GO:0051179	0.978	localization
GO:0006810	0.974	transport
GO:0051641	0.897	cellular localization
GO:0051649	0.890	establishment of localization in cell
GO:0016192	0.885	vesicle-mediated transport
GO:0046907	0.846	intracellular transport
GO:0065007	0.776	biological regulation
GO:0050789	0.654	regulation of biological process
GO:0007034	0.593	vacuolar transport
GO:0007041	0.562	lysosomal transport
GO:0050794	0.557	regulation of cellular process
GO:0008152	0.545	metabolic process
GO:0008333	0.468	endosome to lysosome transport
GO:0007033	0.467	vacuole organization
GO:0071704	0.313	organic substance metabolic process
GO:0044238	0.300	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098796	0.997	membrane protein complex
GO:0031090	0.997	organelle membrane
GO:0005768	0.996	endosome
GO:0098588	0.994	bounding membrane of organelle
GO:0010008	0.973	endosome membrane
GO:0099023	0.964	vesicle tethering complex
GO:0005829	0.958	cytosol
GO:0045202	0.957	synapse
GO:0000323	0.952	lytic vacuole
GO:0005774	0.910	vacuolar membrane
GO:0005764	0.899	lysosome
GO:0030897	0.833	HOPS complex
GO:0098852	0.819	lytic vacuole membrane
GO:0005770	0.815	late endosome
GO:0005765	0.804	lysosomal membrane
GO:0005769	0.743	early endosome
GO:0043232	0.708	intracellular non-membrane-bounded organelle
GO:0005615	0.634	extracellular space
GO:0070062	0.418	extracellular exosome
GO:0033263	0.379	CORVET complex
GO:0005856	0.368	cytoskeleton
GO:0048475	0.356	coated membrane
GO:0030119	0.330	AP-type membrane coat adaptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]