StarFunc result for job id Q9P255

User Input

>input (531 residues)
MLENYRNLVFVGIAASKPDLITCLEQGKEPWNVKRHEMVAEPPVVCSYFARDLWPKQGKK
NYFQKVILRRYKKCGCENLQLRKYCKSMDECKVHKECYNGLNQCLTTTQNKIFQCDKYVK
VFHKFSNSNRHTIRHTGKKSFKCKECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYNE
TSNLSTHKRIHTGKKPYKCEECGKAFNRLSHLTTHKIIHTGKKPYKCEECGKAFNQSANL
TTHKRIHTGEKPYKCEECGRAFSQSSTLTAHKIIHAGEKPYKCEECGKAFSQSSTLTTHK
IIHTGEKFYKCEECGKAFSQLSHLTTHKRIHSGEKPYKCEECGKAFKQSSTLTTHKRIHA
GEKFYKCEVCSKAFSRFSHLTTHKRIHTGEKPYKCEECGKAFNLSSQLTTHKIIHTGEKP
YKCEECGKAFNQSSTLSKHKVIHTGEKPYKYEECGKAFNQSSHLTTHKMIHTGEKPYKCE
ECGKAFNNSSILNRHKMIHTGEKLYKPESCNNACDNIAKISKYKRNCAGEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03923	0.618	0.557	1.015E-61	595	0.738	0.659	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
2	AFDB:Q9H8G1	0.589	0.551	1.584E-61	570	0.697	0.649	Q9H8G1.pdb.gz	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
3	AFDB:A6NNF4	0.563	0.425	3.650E-61	738	0.718	0.516	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
4	AFDB:Q14593	0.465	0.439	1.313E-60	569	0.693	0.647	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
5	AFDB:P35789	0.364	0.317	1.551E-60	620	0.719	0.616	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
6	AFDB:Q05481	0.460	0.236	3.779E-60	1191	0.708	0.316	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
7	AFDB:Q8TD23	0.559	0.525	7.631E-59	568	0.691	0.646	Q8TD23.pdb.gz	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
8	AFDB:Q03936	0.538	0.494	4.529E-58	586	0.708	0.642	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
9	AFDB:O75437	0.512	0.429	1.993E-56	659	0.663	0.534	O75437.pdb.gz	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
10	AFDB:Q8IYB9	0.556	0.468	1.478E-55	648	0.623	0.511	Q8IYB9.pdb.gz	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
11	PDB:3w5kB	0.094	0.272	3.029E-4	110	0.081	0.391	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4fjcE	0.063	0.072	5.548E-1	434	0.060	0.074	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
13	PDB:7ena4	0.078	0.085	6.556E-1	457	0.079	0.092	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	PDB:7o4iW	0.062	0.092	8.190E-1	312	0.066	0.112	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
15	PDB:7nvr3	0.061	0.112	1.144	214	0.053	0.131	7nvr3.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
16	PDB:6f40P	0.067	0.101	2.493	246	0.049	0.106	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
17	PDB:2p01A	0.079	0.110	2.635	323	0.081	0.133	2p01A.pdb.gz
18	PDB:6gejS	0.055	0.107	2.946	208	0.045	0.115	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
19	PDB:7cunA	0.070	0.060	3.114	730	0.043	0.032	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
20	PDB:7tveG	0.060	0.095	3.292	307	0.085	0.147	7tveG.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	543	616	0.525	0.453	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	O75437	542	659	0.537	0.432	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	P17038	533	809	0.550	0.361	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	P35789	731	620	0.714	0.611	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
5	Q03923	760	595	0.740	0.661	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	Q03936	738	586	0.712	0.645	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
7	Q05481	546	1191	0.550	0.245	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	Q14593	715	569	0.695	0.649	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
9	Q15928	566	474	0.531	0.595	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
10	Q2NKJ9	756	569	0.699	0.652	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
11	Q49A12	685	536	0.674	0.668	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
12	Q5JVG8	542	444	0.507	0.606	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
13	Q6ZR52	532	646	0.524	0.430	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
14	Q8IW36	555	515	0.557	0.575	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
15	Q8IYB9	690	648	0.665	0.545	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
16	Q8IYN0	715	542	0.665	0.651	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
17	Q8TD23	720	568	0.693	0.648	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
18	Q96H40	564	463	0.527	0.605	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
19	Q96JC4	654	524	0.633	0.641	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
20	Q9H8G1	752	570	0.699	0.651	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10403 BHD_1	5.9	18.3	Rad4 beta-hairpin domain 1
2	PF01722 BolA	0.00037	32.1	BolA-like protein
3	PF07975 C1_4	16	17.2	TFIIH C1-like domain
4	PF12552 DUF3741	13	17.1	Protein of unknown function (DUF3741)
5	PF04777 Evr1_Alr	12	17.6	Erv1 / Alr family
6	PF07754 HVO_2753_ZBP	8.5e+02	11.2	Small zinc finger protein HVO_2753-like, Zn-binding pocket
7	PF01352 KRAB	2.5e+02	12.7	KRAB box
8	PF01286 XPA_N	1.2e-14	65.4	XPA protein N-terminal
9	PF14149 YhfH	46	15.4	YhfH-like protein
10	PF01428 zf-AN1	0.052	25.0	AN1-like Zinc finger
11	PF00096 zf-C2H2	1.5e-66	228.4	Zinc finger, C2H2 type
12	PF16622 zf-C2H2_11	3.5e-06	38.0	zinc-finger C2H2-type
13	PF13894 zf-C2H2_4	5.7e-37	134.2	C2H2-type zinc finger
14	PF13912 zf-C2H2_6	2.2e-22	89.7	C2H2-type zinc finger
15	PF12171 zf-C2H2_jaz	2.1e-13	61.4	Zinc-finger double-stranded RNA-binding
16	PF13465 zf-H2C2_2	7.2e-102	341.0	Zinc-finger double domain
17	PF02591 zf-RING_7	1.1e-05	36.8	C4-type zinc ribbon domain
18	PF18439 zf_UBZ	2.2e-11	54.5	Ubiquitin-Binding Zinc Finger
19	PF17032 zinc_ribbon_15	2.6e+02	13.8	zinc-ribbon family
20	PF09723 Zn-ribbon_8	3.3e-06	38.4	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000413660

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349891	0.584	Ankyrin repeat domain-containing protein 20A4
2	9606.ENSP00000366826	0.581	Ankyrin repeat domain-containing protein 20A2
3	9606.ENSP00000389243	0.560	Zinc finger protein with KRAB and SCAN domains 7
4	9606.ENSP00000335660	0.556	Keratin-associated protein 19-2
5	9606.ENSP00000345797	0.556	KRAB box domain containing 4
6	9606.ENSP00000440038	0.526	Transcription elongation factor A N-terminal and central domain containing
7	9606.ENSP00000366608	0.519	COBW domain-containing protein 6
8	9606.ENSP00000374390	0.503	Probable G-protein coupled receptor 149

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.625	organic cyclic compound binding
GO:1901363	0.622	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0019222	0.991	regulation of metabolic process
GO:0009889	0.973	regulation of biosynthetic process
GO:0019219	0.973	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.961	regulation of DNA-templated transcription
GO:1903507	0.917	negative regulation of nucleic acid-templated transcription
GO:0045892	0.912	negative regulation of DNA-templated transcription
GO:0009987	0.776	cellular process
GO:0008152	0.317	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.911	intracellular organelle lumen
GO:0031981	0.903	nuclear lumen
GO:0005654	0.806	nucleoplasm
GO:0005737	0.642	cytoplasm
GO:0005829	0.407	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]