StarFunc result for job id Q9P260

User Input

>input (1216 residues)
MAAMAPGGSGSGGGVNPFLSDSDEDDDEVAATEERRAVLRLGAGSGLDPGSAGSLSPQDP
VALGSSARPGLPGEASAAAVALGGTGETPARLSIDAIAAQLLRDQYLLTALELHTELLES
GRELPRLRDYFSNPGNFERQSGTPPGMGAPGVPGAAGVGGAGGREPSTASGGGQLNRAGS
ISTLDSLDFARYSDDGNRETDEKVAVLEFELRKAKETIQALRANLTKAAEHEVPLQERKN
YKSSPEIQEPIKPLEKRALNFLVNEFLLKNNYKLTSITFSDENDDQDFELWDDVGLNIPK
PPDLLQLYRDFGNHQVTGKDLVDVASGVEEDELEALTPIISNLPPTLETPQPAENSMLVQ
KLEDKISLLNSEKWSLMEQIRRLKSEMDFLKNEHFAIPAVCDSVQPPLDQLPHKDSEDSG
QHPDVNSSDKGKNTDIHLSISDEADSTIPKENSPNSFPRREREGMPPSSLSSKKTVHFDK
PNRKLSPAFHQALLSFCRMSADSRLGYEVSRIADSEKSVMLMLGRCLPHIVPNVLLAKRE
ELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAE
LLPQCWEQINHKYPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLMEDKADLVREAV
IKSLGIIMGYIDDPDKYHQGFELLLSALGDPSERVVSATHQVFLPAYAAWTTELGNLQSH
LILTLLNKIEKLLREGEHGLDEHKLHMYLSALQSLIPSLFALVLQNAPFSSKAKLHGEVP
QIEVTRFPRPMSPLQDVSTIIGSREQLAVLLQLYDYQLEQEGTTGWESLLWVVNQLLPQL
IEIVGKINVTSTACVHEFSRFFWRLCRTFGKIFTNTKVKPQFQEILRLSEENIDSSAGNG
VLTKATVPIYATGVLTCYIQEEDRKLLVGFLEDVMTLLSLSHAPLDSLKASFVELGANPA
YHELLLTVLWYGVVHTSALVRCTAARMFELTLRGMSEALVDKRVAPALVTLSSDPEFSVR
IATIPAFGTIMETVIQRELLERVKMQLASFLEDPQYQDQHSLHTEIIKTFGRVGPNAEPR
FRDEFVIPHLHKLALVNNLQIVDSKRLDIATHLFEAYSALSCCFISEDLMVNHFLPGLRC
LRTDMEHLSPEHEVILSSMIKECEQKVENKTVQEPQGSMSIAASLVSEDTKTKFLNKMGQ
LTTSGAMLANVFQRKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q148V7	0.683	0.683	0.000	1216	0.933	0.933	Q148V7.pdb.gz	RELCH_MOUSE RAB11-binding protein RELCH OS=Mus musculus OX=10090 GN=Relch PE=1 SV=1
2	PDB:1b3uA	0.174	0.275	2.454E-8	588	0.074	0.153	1b3uA.pdb.gz
3	AFDB:G0S024	0.075	0.079	1.664E-6	1112	0.127	0.139	G0S024.pdb.gz	NIC96_CHATD Nucleoporin NIC96 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NIC96 PE=1 SV=1
4	PDB:6xu2A	0.170	0.185	4.996E-6	1091	0.080	0.089	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
5	PDB:4jlqA	0.155	0.208	6.041E-6	840	0.085	0.123	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
6	PDB:7k36A	0.151	0.280	1.243E-5	554	0.076	0.166	7k36A.pdb.gz	Cryo-EM structure of the Hippo signaling integrator human STRIPAK.
7	PDB:7unkA	0.146	0.166	1.243E-5	1047	0.104	0.120	7unkA.pdb.gz
8	PDB:1qgkA	0.159	0.205	2.115E-5	876	0.100	0.139	1qgkA.pdb.gz
9	PDB:3w3uA	0.126	0.138	2.370E-5	1030	0.075	0.088	3w3uA.pdb.gz
10	PDB:4a0cA	0.140	0.146	2.977E-5	1155	0.078	0.082	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
11	PDB:5gm6G	0.134	0.168	3.336E-5	875	0.090	0.125	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
12	PDB:1qbkB	0.158	0.204	4.033E-5	880	0.077	0.107	1qbkB.pdb.gz	Structure of the nuclear transport complex karyopherin-beta2-Ran x GppNHp.
13	AFDB:Q8C0Y0	0.170	0.220	5.269E-5	875	0.088	0.122	Q8C0Y0.pdb.gz	PP4R4_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 4 OS=Mus musculus OX=10090 GN=Ppp4r4 PE=1 SV=2
14	AFDB:Q9M033	0.186	0.162	6.133E-5	1467	0.127	0.105	Q9M033.pdb.gz	Q9M033_ARATH HEAT repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=ESP4 PE=1 SV=1
15	AFDB:Q13099	0.121	0.162	1.526E-4	824	0.081	0.120	Q13099.pdb.gz	IFT88_HUMAN Intraflagellar transport protein 88 homolog OS=Homo sapiens OX=9606 GN=IFT88 PE=1 SV=3
16	AFDB:P33202	0.143	0.123	2.596E-4	1483	0.089	0.073	P33202.pdb.gz	UFD4_YEAST Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UFD4 PE=1 SV=1
17	AFDB:O74365	0.090	0.112	5.142E-4	865	0.101	0.142	O74365.pdb.gz	SOL1_SCHPO SWI/SNF chromatin-remodeling complex subunit sol1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sol1 PE=1 SV=1
18	AFDB:P78759	0.142	0.228	5.763E-4	627	0.075	0.145	P78759.pdb.gz	2AD2_SCHPO Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta 2 isoform OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=par2 PE=1 SV=2
19	AFDB:P58501	0.081	0.095	1.099E-3	919	0.116	0.153	P58501.pdb.gz	PAXB1_MOUSE PAX3- and PAX7-binding protein 1 OS=Mus musculus OX=10090 GN=Paxbp1 PE=1 SV=3
20	AFDB:Q9VJ35	0.125	0.096	1.547E-3	1732	0.144	0.101	Q9VJ35.pdb.gz	Q9VJ35_DROME LD01527p OS=Drosophila melanogaster OX=7227 GN=ssp3 PE=2 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q148V7	0.0	2289	1216	0.933	0.933	RELCH_MOUSE RAB11-binding protein RELCH OS=Mus musculus OX=10090 GN=Relch PE=1 SV=1
2	Q9P260	0.0	2498	1216	1.000	1.000	RELCH_HUMAN RAB11-binding protein RELCH OS=Homo sapiens OX=9606 GN=RELCH PE=1 SV=2
3	Q9UT08	0.052	40.0	590	0.030	0.061	2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=paa1 PE=1 SV=1
4	Q8IMV1	0.22	37.7	309	0.013	0.052	Q8IMV1_DROME Elastin-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Elal PE=4 SV=1
5	D2CFN3	0.23	38.1	1186	0.025	0.026	D2CFN3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:dkey-178j17.2 PE=2 SV=1
6	Q8SY52	0.23	37.7	329	0.013	0.049	Q8SY52_DROME Elastin-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Elal PE=2 SV=1
7	Q8NBK3	0.30	37.4	374	0.039	0.128	SUMF1_HUMAN Formylglycine-generating enzyme OS=Homo sapiens OX=9606 GN=SUMF1 PE=1 SV=3
8	F4I893	0.72	36.6	2696	0.026	0.012	ILA_ARATH Protein ILITYHIA OS=Arabidopsis thaliana OX=3702 GN=ILA PE=1 SV=1
9	Q4GZ81	2.7	34.7	573	0.018	0.038	Q4GZ81_TRYB2 Serine/threonine protein phosphatase 2a regulatory subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1380 PE=4 SV=1
10	P31383	2.8	34.7	635	0.023	0.044	2AAA_YEAST Protein phosphatase PP2A regulatory subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPD3 PE=1 SV=3
11	O75054	4.8	33.9	1194	0.024	0.024	IGSF3_HUMAN Immunoglobulin superfamily member 3 OS=Homo sapiens OX=9606 GN=IGSF3 PE=2 SV=3
12	Q9JHW1	5.6	33.9	1378	0.035	0.030	CBPD_RAT Carboxypeptidase D OS=Rattus norvegicus OX=10116 GN=Cpd PE=1 SV=2
13	Q54Y98	5.8	33.1	326	0.019	0.071	TRA2_DICDI Transformer-2 protein homolog OS=Dictyostelium discoideum OX=44689 GN=tra2 PE=3 SV=1
14	P52590	6.0	33.5	926	0.016	0.022	NU107_RAT Nuclear pore complex protein Nup107 OS=Rattus norvegicus OX=10116 GN=Nup107 PE=1 SV=1
15	A8K7B7	6.3	33.5	589	0.020	0.041	A8K7B7_HUMAN Protein phosphatase 2 (Formerly 2A), regulatory subunit A (PR 65), alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=1
16	P30153	6.3	33.5	589	0.020	0.041	2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4
17	Q382J7	6.4	33.5	660	0.029	0.053	Q382J7_TRYB2 Bromo domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5000 PE=1 SV=1
18	Q76MZ3	6.4	33.5	589	0.020	0.041	2AAA_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus OX=10090 GN=Ppp2r1a PE=1 SV=3
19	Q32PI5	6.6	33.5	589	0.020	0.041	2AAA_BOVIN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Bos taurus OX=9913 GN=PPP2R1A PE=1 SV=1
20	Q5EGE1	7.4	33.1	461	0.014	0.037	ISM1_DANRE Isthmin-1 OS=Danio rerio OX=7955 GN=ism1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02985 HEAT	9.9e-11	51.9	HEAT repeat
2	PF13646 HEAT_2	5.7e-05	34.8	HEAT repeats
3	PF13513 HEAT_EZ	1e+02	14.9	HEAT-like repeat
4	PF12325 TMF_TATA_bd	1.4e+02	13.9	TATA element modulatory factor 1 TATA binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381198

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261778	0.778	Transport and golgi organization 6 homolog
2	9606.ENSP00000216036	0.769	Radial spoke head 14 homolog
3	9606.ENSP00000269499	0.746	Zinc finger CCHC-type containing 2
4	9606.ENSP00000434466	0.745	Integrator complex subunit 4
5	9606.ENSP00000377036	0.734	Serine/threonine-protein phosphatase 2A activator
6	9606.ENSP00000279387	0.712	Serine/threonine-protein phosphatase 4 catalytic subunit
7	9606.ENSP00000184956	0.711	HEAT repeat-containing protein 6
8	9606.ENSP00000000412	0.668	Cation-dependent mannose-6-phosphate receptor
9	9606.ENSP00000295709	0.653	Serine/threonine-protein kinase 36
10	9606.ENSP00000297440	0.645	Dynein assembly factor 5, axonemal
11	9606.ENSP00000450444	0.645	HEAT repeat-containing protein 4
12	9606.ENSP00000468424	0.622	Glycylpeptide N-tetradecanoyltransferase 1
13	9606.ENSP00000263847	0.590	Oxysterol-binding protein 1
14	9606.ENSP00000296292	0.577	Protein RFT1 homolog
15	9606.ENSP00000430774	0.575	Uncharacterized protein
16	9606.ENSP00000254442	0.569	WD repeat-containing protein 7
17	9606.ENSP00000263102	0.569	Coiled-coil domain containing 6
18	9606.ENSP00000354573	0.546	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5
19	9606.ENSP00000392718	0.544	POTE ankyrin domain family member I
20	9606.ENSP00000392147	0.516	Protein phosphatase 6 catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0015918	0.981	sterol transport
GO:0032365	0.981	intracellular lipid transport
GO:0030301	0.970	cholesterol transport
GO:0065007	0.627	biological regulation
GO:0050789	0.623	regulation of biological process
GO:0050794	0.462	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	0.998	endosome
GO:0055037	0.992	recycling endosome
GO:0005829	0.928	cytosol
GO:0005794	0.550	Golgi apparatus
GO:0031984	0.507	organelle subcompartment
GO:0098791	0.494	Golgi apparatus subcompartment
GO:0043232	0.480	intracellular non-membrane-bounded organelle
GO:0016020	0.429	membrane
GO:0005802	0.388	trans-Golgi network
GO:0032991	0.362	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]