StarFunc result for job id Q9P265

User Input

>input (1576 residues)
MAERGLEPSPAAVAALPPEVRAQLAELELELSEGDITQKGYEKKRSKLLSPYSPQTQETD
SAVQKELRNQTPAPSAAQTSAPSKYHRTRSGGARDERYRSDIHTEAVQAALAKHKEQKMA
LPMPTKRRSTFVQSPADACTPPDTSSASEDEGSLRRQAALSAALQQSLQNAESWINRSIQ
GSSTSSSASSTLSHGEVKGTSGSLADVFANTRIENFSAPPDVTTTTSSSSSSSSIRPANI
DLPPSGIVKGMHKGSNRSSLMDTADGVPVSSRVSTKIQQLLNTLKRPKRPPLKEFFVDDS
EEIVEVPQPDPNQPKPEGRQMTPVKGEPLGVICNWPPALESALQRWGTTQAKCSCLTALD
MTGKPVYTLTYGKLWSRSLKLAYTLLNKLGTKNEPVLKPGDRVALVYPNNDPVMFMVAFY
GCLLAEVIPVPIEVPLTRKDAGGQQIGFLLGSCGIALALTSEVCLKGLPKTQNGEIVQFK
GWPRLKWVVTDSKYLSKPPKDWQPHISPAGTEPAYIEYKTSKEGSVMGVTVSRLAMLSHC
QALSQACNYSEGETIVNVLDFKKDAGLWHGMFANVMNKMHTISVPYSVMKTCPLSWVQRV
HAHKAKVALVKCRDLHWAMMAHRDQRDVSLSSLRMLIVTDGANPWSVSSCDAFLSLFQSH
GLKPEAICPCATSAEAMTVAIRRPGVPGAPLPGRAILSMNGLSYGVIRVNTEDKNSALTV
QDVGHVMPGGMMCIVKPDGPPQLCKTDEIGEICVSSRTGGMMYFGLAGVTKNTFEVIPVN
SAGSPVGDVPFIRSGLLGFVGPGSLVFVVGKMDGLLMVSGRRHNADDIVATGLAVESIKT
VYRGRIAVFSVSVFYDERIVVVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVP
ANTLPKTPLGGIHISQTKQLFLEGSLHPCNILMCPHTCVTNLPKPRQKQPGVGPASVMVG
NLVAGKRIAQAAGRDLGQIEENDLVRKHQFLAEILQWRAQATPDHVLFMLLNAKGTTVCT
ASCLQLHKRAERIASVLGDKGHLNAGDNVVLLYPPGIELIAAFYGCLYAGCIPVTVRPPH
AQNLTATLPTVRMIVDVSKAACILTSQTLMRLLRSREAAAAVDVKTWPTIIDTDDLPRKR
LPQLYKPPTPEMLAYLDFSVSTTGMLTGVKMSHSAVNALCRAIKLQCELYSSRQIAICLD
PYCGLGFALWCLCSVYSGHQSVLIPPMELENNLFLWLSTVNQYKIRDTFCSYSVMELCTK
GLGNQVEVLKTRGINLSCVRTCVVVAEERPRVALQQSFSKLFKDIGLSPRAVSTTFGSRV
NVAICLQGTSGPDPTTVYVDLKSLRHDRVRLVERGAPQSLLLSESGKILPGVKVVIVNPE
TKGPVGDSHLGEIWVNSPHTASGYYTIYDSETLQADHFNTRLSFGDAAQTLWARTGYLGF
VRRTELTAATGERHDALYVVGALDETLELRGLRYHPIDIETSVSRIHRSIAECAVFTWTN
LLVVVVELCGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDPGVIPINSRGEKQRMHLRD
SFLADQLDPIYVAYNM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P265	1.000	1.000	0.000	1576	1.000	1.000	Q9P265.pdb.gz	DIP2B_HUMAN Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3
2	PDB:5hm3A	0.322	0.774	4.924E-37	625	0.082	0.206	5hm3A.pdb.gz	Structure of the Essential Mtb FadD32 Enzyme: A Promising Drug Target for Treating Tuberculosis.
3	PDB:5bsmA	0.270	0.724	1.072E-27	530	0.067	0.198	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
4	PDB:1ultA	0.238	0.619	3.679E-27	533	0.066	0.195	1ultA.pdb.gz
5	PDB:3r44A	0.256	0.716	3.679E-27	502	0.059	0.185	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
6	PDB:6q2mA	0.277	0.728	6.635E-27	544	0.060	0.175	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
7	PDB:7kydA	0.269	0.713	7.793E-27	534	0.064	0.189	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
8	PDB:5ie2A	0.261	0.737	2.277E-26	506	0.057	0.178	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
9	PDB:5ja2A	0.234	0.292	1.843E-25	1238	0.056	0.072	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.
10	PDB:3b7wA	0.237	0.627	2.284E-25	537	0.057	0.168	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
11	PDB:3rg2C	0.233	0.555	3.005E-23	613	0.058	0.150	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
12	AFDB:Q9FNM7	0.071	0.108	1.727E-2	850	0.065	0.120	Q9FNM7.pdb.gz	RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana OX=3702 GN=RH26 PE=1 SV=2
13	AFDB:O43078	0.069	0.130	8.625E-2	660	0.055	0.130	O43078.pdb.gz	ALF1_SCHPO ATPase-like fidgetin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alf1 PE=1 SV=1
14	AFDB:P90897	0.068	0.099	1.013E-1	959	0.054	0.089	P90897.pdb.gz	RDE12_CAEEL DEAD-box ATP-dependent RNA helicase rde-12 OS=Caenorhabditis elegans OX=6239 GN=rde-12 PE=1 SV=4
15	AFDB:Q55AX2	0.031	0.028	1.474E-1	1845	0.045	0.038	Q55AX2.pdb.gz	DOT1L_DICDI Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Dictyostelium discoideum OX=44689 GN=dotA PE=2 SV=2
16	AFDB:J3KN66	0.061	0.122	3.669E-1	599	0.050	0.132	J3KN66.pdb.gz	J3KN66_HUMAN Torsin 1A interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1 PE=1 SV=1
17	AFDB:D4AIA8	0.053	0.096	4.546E-1	784	0.044	0.088	D4AIA8.pdb.gz	D4AIA8_ASPOZ AAA ATPase OS=Aspergillus oryzae OX=5062 GN=aipA PE=4 SV=1
18	AFDB:Q9Z330	0.026	0.026	5.340E-1	1622	0.034	0.033	Q9Z330.pdb.gz	DNMT1_RAT DNA (cytosine-5)-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Dnmt1 PE=1 SV=2
19	AFDB:Q5QJC4	0.049	0.071	5.634E-1	972	0.050	0.081	Q5QJC4.pdb.gz	DCR1A_CHICK DNA cross-link repair 1A protein OS=Gallus gallus OX=9031 GN=DCLRE1A PE=1 SV=1
20	AFDB:Q8C0E5	0.046	0.108	8.651E-1	555	0.046	0.132	Q8C0E5.pdb.gz	Q8C0E5_MOUSE SEFIR domain-containing protein OS=Mus musculus OX=10090 GN=Traf3ip2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14689	0.0	2286	1571	0.718	0.720	DIP2A_HUMAN Disco-interacting protein 2 homolog A OS=Homo sapiens OX=9606 GN=DIP2A PE=1 SV=2
2	Q3UH60	0.0	3192	1574	0.979	0.980	DIP2B_MOUSE Disco-interacting protein 2 homolog B OS=Mus musculus OX=10090 GN=Dip2b PE=1 SV=1
3	Q8BWT5	0.0	2238	1523	0.709	0.734	DIP2A_MOUSE Disco-interacting protein 2 homolog A OS=Mus musculus OX=10090 GN=Dip2a PE=1 SV=3
4	Q9P265	0.0	3257	1576	1.000	1.000	DIP2B_HUMAN Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3
5	Q9W0S9	0.0	1623	1773	0.551	0.490	DIP2_DROME Disco-interacting protein 2 OS=Drosophila melanogaster OX=7227 GN=DIP2 PE=1 SV=2
6	Q10250	7.89e-82	300	1517	0.223	0.232	YD22_SCHPO Uncharacterized protein C56F8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC56F8.02 PE=4 SV=1
7	P95141	1.24e-30	132	619	0.097	0.247	FAA29_MYCTU 4-hydroxyphenylalkanoate adenylyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD29 PE=1 SV=1
8	Q09773	1.53e-30	134	1487	0.124	0.132	MUG62_SCHPO Meiotically up-regulated gene 62 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug62 PE=1 SV=2
9	Q12275	1.14e-29	131	1648	0.110	0.105	YO093_YEAST Uncharacterized protein YOR093C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR093C PE=1 SV=1
10	Q9I157	2.46e-28	127	4342	0.090	0.033	Q9I157_PSEAE PvdL OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pvdL PE=4 SV=1
11	Q7TXM1	4.00e-27	120	583	0.099	0.268	FAA26_MYCBO Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=fadD26 PE=1 SV=1
12	P9WQ43	9.48e-27	119	583	0.098	0.266	FAA26_MYCTU Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD26 PE=1 SV=1
13	P9WQ45	4.17e-25	114	583	0.093	0.250	FAD25_MYCTU Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD25 PE=1 SV=1
14	O53580	6.43e-24	111	637	0.091	0.224	FAA32_MYCTU Long-chain-fatty-acid--AMP ligase FadD32 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD32 PE=1 SV=1
15	P9WQ59	1.29e-22	106	580	0.089	0.243	FAA28_MYCTU Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD28 PE=1 SV=1
16	P9WQ49	1.91e-22	106	578	0.090	0.246	FAD21_MYCTU Putative fatty-acid--CoA ligase FadD21 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD21 PE=1 SV=1
17	P9WQ57	4.48e-22	105	585	0.093	0.250	FAA30_MYCTU Probable long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD30 PE=1 SV=1
18	P9WQ47	8.62e-20	97.8	584	0.089	0.241	FAA23_MYCTU Long-chain-fatty-acid--AMP ligase FadD23 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD23 PE=1 SV=1
19	Q9VDU4	7.41e-10	65.9	537	0.034	0.099	Q9VDU4_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Acsx1L PE=3 SV=2
20	Q9VDU3	2.60e-09	64.3	546	0.034	0.097	Q9VDU3_DROME RE32325p OS=Drosophila melanogaster OX=7227 GN=Acsx1R PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	4.6e-89	310.6	AMP-binding enzyme
2	PF06464 DMAP_binding	4.6e-34	129.0	DMAP1-binding Domain
3	PF05120 GvpG	2	19.9	Gas vesicle protein G

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301180

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361363	0.909	DNA methyltransferase 1-associated protein 1
2	9606.ENSP00000282908	0.620	Serine/threonine kinase 32B
3	9606.ENSP00000475915	0.603	Connector enhancer of kinase suppressor of ras 3
4	9606.ENSP00000283195	0.587	E3 SUMO-protein ligase RanBP2
5	9606.ENSP00000280325	0.586	Uncharacterized protein C11orf53
6	9606.ENSP00000484135	0.556	Colorectal cancer associated 2
7	9606.ENSP00000329995	0.524	Protein FAM186A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.998	catalytic activity
GO:0016874	0.968	ligase activity
GO:0016877	0.800	ligase activity, forming carbon-sulfur bonds
GO:0016878	0.785	acid-thiol ligase activity
GO:0016405	0.780	CoA-ligase activity
GO:0016740	0.474	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0016043	0.989	cellular component organization
GO:0019222	0.987	regulation of metabolic process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0048519	0.966	negative regulation of biological process
GO:0080090	0.964	regulation of primary metabolic process
GO:0051171	0.956	regulation of nitrogen compound metabolic process
GO:0009893	0.883	positive regulation of metabolic process
GO:0010604	0.867	positive regulation of macromolecule metabolic process
GO:0050794	0.858	regulation of cellular process
GO:0051173	0.847	positive regulation of nitrogen compound metabolic process
GO:1901983	0.829	regulation of protein acetylation
GO:0051247	0.821	positive regulation of protein metabolic process
GO:0048523	0.790	negative regulation of cellular process
GO:1901985	0.745	positive regulation of protein acetylation
GO:0051128	0.724	regulation of cellular component organization
GO:0008152	0.719	metabolic process
GO:2000756	0.701	regulation of peptidyl-lysine acetylation
GO:0050793	0.700	regulation of developmental process
GO:0071704	0.679	organic substance metabolic process
GO:0008361	0.674	regulation of cell size
GO:0045926	0.670	negative regulation of growth
GO:0030308	0.658	negative regulation of cell growth
GO:0010721	0.657	negative regulation of cell development
GO:0120035	0.651	regulation of plasma membrane bounded cell projection organization
GO:0048640	0.650	negative regulation of developmental growth
GO:0051961	0.646	negative regulation of nervous system development
GO:0050768	0.631	negative regulation of neurogenesis
GO:0050770	0.630	regulation of axonogenesis
GO:0051129	0.627	negative regulation of cellular component organization
GO:0010977	0.615	negative regulation of neuron projection development
GO:0050771	0.595	negative regulation of axonogenesis
GO:0030516	0.582	regulation of axon extension
GO:0030517	0.522	negative regulation of axon extension
GO:0044238	0.482	primary metabolic process
GO:2000758	0.378	positive regulation of peptidyl-lysine acetylation
GO:0044237	0.369	cellular metabolic process
GO:0006807	0.347	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.995	nucleus
GO:0005737	0.993	cytoplasm
GO:0016020	0.988	membrane
GO:0036477	0.779	somatodendritic compartment
GO:0043005	0.730	neuron projection
GO:0005576	0.657	extracellular region
GO:0030425	0.622	dendrite
GO:0071944	0.555	cell periphery
GO:0070013	0.535	intracellular organelle lumen
GO:0070062	0.514	extracellular exosome
GO:0031981	0.506	nuclear lumen
GO:0005886	0.503	plasma membrane
GO:0005654	0.487	nucleoplasm
GO:0005829	0.445	cytosol
GO:0012505	0.399	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.-.-.-	0.968	Ligases.
EC:6.2.-.-	0.800	Forming carbon-sulfur bonds.
EC:6.2.1.-	0.785	Acid--thiol ligases.
EC:2.-.-.-	0.474	Transferases.

[back to server]