StarFunc result for job id Q9P266

User Input

>input (1359 residues)
MYSVEDLLISHGYKLSRDPPASREDNPKGRQAARTGTRAGQGLQNGHEDGPAALAHRKTS
AGKGHVSDSESRRSTPRGHGEPQSTSASRTSEAGFCNQPPSAWSSHPPTGNDQAYRRRGR
QEARSQKPREHENLEARGMAQAHSLPVHVREGPWEVGGRSEHVMKKPVWEEELRMSGPAK
WQNVSLESWNQPRKLGRQMSDGDGERLFQDLYPFIQGEHVLNSQNKGKSRSLPRVLSPES
LSCTEIPIPLNERHSPKMPPYPPTCAPNLDSTRNSEKSGCSAPFPRPKFGRPLKPPSYSS
HQQSRGGADSSDSQDSQQMDAYVPRHELCLSDPGLEPPVYVPPPSYRSPPQNIPNPYLED
TVPINVCGGHSQQQSPTEKAGASGQPPSGPPGTGNEYGVSPRLPQGLPAHPRPVTAYDGF
VQYIPFDDPRLRHFKLAQPQGFCEDIKLDDKSYNSSPVTAQEPAHGGMQPDGAIWNPQSL
IPPSGDERGLVLADSSPRWLWGQPPGDGENSGLPNQRDRCVARGQWPDVRGSQHGHTGRQ
VSSPYSQGESTCETQTKLKKFQTGTRTKKSSKKKMNETIFCLVSIPVKSESHLPDRDMDN
NDLKPSADQKNGSDKSPALQEQSLLSMSSTDLELQALTGSMGGRTEFQKQDLGEPEEDRQ
TNDLSFIHLTKHRELKHSGSWPGHRYRDQQTQTSFSEEPQSSQLLPGAKLGGPSRAALSP
KCSDPAASEAQTHTAFPTGDHKQRPSARNLKGHRSLSPSSNSAFSRTSLSVDQAPTPKAG
RSQPCVDVHGLGAHPGPKREVVKGEPTGPCNSKQLFGQFLLKPVSRRPWDLISQLESFNK
ELQEEEESSSSSSSSSSSSEESEAEPQQENRAHCRQEDVGFRGNSPEMRVEPQPRMWVPE
SPVCRSGRGESKSESWSEELQPGHPRAWPPSPGRFRVEEGGGAPFCSADGSTSAEKRHLE
VSNGMDELAGSPFPVTRMSSRSSDAKPLPASYPAEPREPQESPKITSAFSSVKPSEAVPR
KFDSGGERGAGLPLSLSNKNRGLSAPDLRSVGLTPGQEQGASELEGSLGEASTIEIPPGE
SLQARAARILGIEVAVESLLPGIRRAGQNQPAEPDASACTPESPQEELLSRPAPADVPRV
STDAFYGRRKCGWTKSPLFVGDRDSARRAPQAFEHSDVDGVVTSTDPVPEPEPSPLESKF
FEQKDVETKPPFRSTLFHFVERTPSVAGSEKRLRSPSKVIESLQEKLASPPRRADPDRLM
RMKEVSSVSRMRVLSFRNADSQEDAEELKATTRGQAGLPGGLVSPGSGDRAQRLGHSLSV
SKDSISREEKEHPAAQKEKSMDQDFWCPDSYDPSRVERV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P266	0.999	0.999	0.000	1359	1.000	1.000	Q9P266.pdb.gz	JCAD_HUMAN Junctional cadherin 5-associated protein OS=Homo sapiens OX=9606 GN=JCAD PE=1 SV=3
2	AFDB:Q5DTX6	0.231	0.236	6.669E-81	1320	0.537	0.553	Q5DTX6.pdb.gz	JCAD_MOUSE Junctional cadherin 5-associated protein OS=Mus musculus OX=10090 GN=Jcad PE=1 SV=2
3	AFDB:Q8IRB5	0.038	0.036	4.339E-4	1465	0.137	0.127	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
4	AFDB:X2JEM2	0.036	0.027	3.508E-3	2326	0.148	0.086	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
5	AFDB:Q94185	0.040	0.043	6.742E-3	1254	0.113	0.123	Q94185.pdb.gz	Q94185_CAEEL DumPY: shorter than wild-type OS=Caenorhabditis elegans OX=6239 GN=dpy-6 PE=1 SV=2
6	AFDB:P51611	0.039	0.030	1.295E-2	2090	0.160	0.104	P51611.pdb.gz	HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus OX=10036 GN=HCFC1 PE=1 SV=1
7	AFDB:Q02952	0.053	0.042	1.295E-2	1782	0.169	0.129	Q02952.pdb.gz	AKA12_HUMAN A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4
8	AFDB:Q2LAE1	0.036	0.032	2.046E-2	1759	0.152	0.118	Q2LAE1.pdb.gz	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
9	AFDB:Q583D6	0.034	0.032	2.657E-2	1471	0.133	0.123	Q583D6.pdb.gz	Q583D6_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.880 PE=3 SV=1
10	AFDB:Q86V38	0.035	0.038	2.657E-2	1191	0.147	0.168	Q86V38.pdb.gz	Q86V38_HUMAN Atrophin 1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=1
11	PDB:7et3O	0.018	0.333	1.422	69	0.012	0.232	7et3O.pdb.gz	Structural basis for genome packaging, retention, and ejection in human cytomegalovirus.
12	PDB:7o4i1	0.036	0.082	4.042	522	0.007	0.019	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
13	PDB:6yxyAE	0.031	0.083	7.767	434	0.007	0.021	6yxyAE.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
14	PDB:7mq8LU	0.033	0.087	7.767	445	0.008	0.025	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5DTX6	0.0	1130	1320	0.540	0.556	JCAD_MOUSE Junctional cadherin 5-associated protein OS=Mus musculus OX=10090 GN=Jcad PE=1 SV=2
2	Q9P266	0.0	2750	1359	1.000	1.000	JCAD_HUMAN Junctional cadherin 5-associated protein OS=Homo sapiens OX=9606 GN=JCAD PE=1 SV=3
3	Q8MQZ0	6.6	33.1	249	0.020	0.108	Q8MQZ0_DROME RE26756p OS=Drosophila melanogaster OX=7227 GN=TSG101 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15351 JCAD	0	2329.3	Junctional protein associated with coronary artery disease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364526

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401831	0.766	Acyl-CoA synthetase family member 2, mitochondrial
2	9606.ENSP00000379709	0.742	Rho GTPase-activating protein 21
3	9606.ENSP00000354504	0.739	Astrotactin-2
4	9606.ENSP00000363397	0.729	Ceramide glucosyltransferase
5	9606.ENSP00000372035	0.654	Serine/threonine-protein kinase LATS2
6	9606.ENSP00000263063	0.619	Poly(A) RNA polymerase, mitochondrial
7	9606.ENSP00000355672	0.580	Putative transferase CAF17, mitochondrial
8	9606.ENSP00000373472	0.567	A disintegrin and metalloproteinase with thrombospondin motifs 7
9	9606.ENSP00000411084	0.556	Zinc finger protein 799
10	9606.ENSP00000330601	0.555	HHIP-like protein 1
11	9606.ENSP00000376421	0.540	Protein sidekick-2
12	9606.ENSP00000482954	0.537	Prolactin receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.990	regulation of cellular process
GO:0023051	0.956	regulation of signaling
GO:0010646	0.956	regulation of cell communication
GO:0048583	0.901	regulation of response to stimulus
GO:0048518	0.861	positive regulation of biological process
GO:0009966	0.859	regulation of signal transduction
GO:0048522	0.781	positive regulation of cellular process
GO:0009987	0.644	cellular process
GO:0048584	0.540	positive regulation of response to stimulus
GO:0051239	0.492	regulation of multicellular organismal process
GO:1902531	0.468	regulation of intracellular signal transduction
GO:0009967	0.372	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005911	0.999	cell-cell junction
GO:0005886	0.998	plasma membrane
GO:0005622	0.995	intracellular anatomical structure
GO:0005737	0.994	cytoplasm
GO:0098590	0.968	plasma membrane region
GO:0042995	0.939	cell projection
GO:0120025	0.922	plasma membrane bounded cell projection
GO:0031253	0.907	cell projection membrane
GO:0031252	0.875	cell leading edge
GO:0048471	0.872	perinuclear region of cytoplasm
GO:0032587	0.861	ruffle membrane
GO:0043226	0.825	organelle
GO:0005912	0.785	adherens junction
GO:0043227	0.736	membrane-bounded organelle
GO:0043229	0.688	intracellular organelle
GO:0043231	0.486	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]