StarFunc result for job id Q9P267

User Input

>input (1494 residues)
MNGGKECDGGDKEGGLPAIQVPVGWQRRVDQNGVLYVSPSGSLLSCLEQVKTYLLTDGTC
KCGLECPLILPKVFNFDPGAAVKQRTAEDVKADEDVTKLCIHKRKIIAVATLHKSMEAPH
PSLVLTSPGGGTNATPVVPSRAATPRSVRNKSHEGITNSVMPECKNPFKLMIGSSNAMGR
LYVQELPGSQQQELHPVYPRQRLGSSEHGQKSPFRGSHGGLPSPASSGSQIYGDGSISPR
TDPLGSPDVFTRSNPGFHGAPNSSPIHLNRTPLSPPSVMLHGSPVQSSCAMAGRTNIPLS
PTLTTKSPVMKKPMCNFSTNMEIPRAMFHHKPPQGPPPPPPPSCALQKKPLTSEKDPLGI
LDPIPSKPVNQNPVIINPTSFHSNVHSQVPMMNVSMPPAVVPLPSNLPLPTVKPGHMNHG
SHVQRVQHSASTSLSPSPVTSPVHMMGTGIGRIEASPQRSRSSSTSSDHGNFMMPPVGPQ
ATSSGIKVPPRSPRSTIGSPRPSMPSSPSTKSDGHHQYKDIPNPLIAGISNVLNTPSSAA
FPTASAGSSSVKSQPGLLGMPLNQILNQHNAASFPASSLLSAAAKAQLANQNKLAGNNSS
SSSNSGAVAGSGNTEGHSTLNTMFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRK
QPPTTVLSLLRQSQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNST
PGCGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHL
AGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTPVIPNSIVSSYNQTSSEAG
GSGPSSSIAIAGTNHPAITKTTSVLQDGVIVTTAAGNPLQSQLPIGSDFPFVGQEHALHF
PSNSTSNNHLPHPLNPSLLSSLPISLPVNQQHLLNQNLLNILQPSAGEGDMSSINNTLSN
HQLTHLQSLLNNNQMFPPNQQQQQLLQGYQNLQAFQGQSTIPCPANNNPMACLFQNFQVR
MQEDAALLNKRISTQPGLTALPENPNTTLPPFQDTPCELQPRIDPSLGQQVKDGLVVGGP
GDASVDAIYKAVVDAASKGMQVVITTAVNSTTQISPIPALSAMSAFTASIGDPLNLSSAV
SAVIHGRNMGGVDHDGRLRNSRGARLPKNLDHGKNVNEGDGFEYFKSASCHTSKKQWDGE
QSPRGERNRWKYEEFLDHPGHIHSSPCHERPNNVSTLPFLPGEQHPILLPPRNCPGDKIL
EENFRYNNYKRTMMSFKERLENTVERCAHINGNRPRQSRGFGELLSTAKQDLVLEEQSPS
SSNSLENSLVKDYIHYNGDFNAKSVNGCVPSPSDAKSISSEDDLRNPDSPSSNELIHYRP
RTFNVGDLVWGQIKGLTSWPGKLVREDDVHNSCQQSPEEGKVEPEKLKTLTEGLEAYSRV
RKRNRKSGKLNNHLEAAIHEAMSELDKMSGTVHQIPQGDRQMRPPKPKRRKISR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AYB6	0.248	0.247	0.000	1498	0.952	0.949	B1AYB6.pdb.gz	MBD5_MOUSE Methyl-CpG-binding domain protein 5 OS=Mus musculus OX=10090 GN=Mbd5 PE=2 SV=1
2	AFDB:A0A024RBA3	0.065	0.094	1.745E-13	1003	0.166	0.247	A0A024RBA3.pdb.gz
3	AFDB:X1WFM6	0.077	0.086	2.099E-13	1320	0.194	0.220	X1WFM6.pdb.gz	X1WFM6_DANRE Methyl-CpG-binding domain protein 6 OS=Danio rerio OX=7955 GN=mbd6 PE=4 SV=1
4	AFDB:Q8N3D4	0.031	0.030	8.515E-5	1523	0.118	0.116	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
5	AFDB:D3ZRA6	0.042	0.039	5.398E-4	1683	0.149	0.133	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
6	AFDB:P98081	0.045	0.032	1.130E-3	2224	0.178	0.120	P98081.pdb.gz	DAB_DROME Protein disabled OS=Drosophila melanogaster OX=7227 GN=Dab PE=1 SV=2
7	AFDB:Q8IQT4	0.039	0.031	1.278E-3	2133	0.155	0.109	Q8IQT4.pdb.gz	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
8	AFDB:F8VQG7	0.050	0.046	4.115E-3	1678	0.129	0.115	F8VQG7.pdb.gz	F8VQG7_MOUSE NEDD4 binding protein 2 OS=Mus musculus OX=10090 GN=N4bp2 PE=1 SV=1
9	AFDB:Q3UH66	0.041	0.032	5.598E-3	2149	0.161	0.112	Q3UH66.pdb.gz	WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus musculus OX=10090 GN=Wnk2 PE=1 SV=2
10	AFDB:O70511	0.035	0.024	7.162E-3	2622	0.127	0.072	O70511.pdb.gz	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
11	PDB:7ao8C	0.023	0.425	7.360E-1	64	0.008	0.188	7ao8C.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
12	PDB:5ltlB	0.021	0.221	1.132	68	0.007	0.147	5ltlB.pdb.gz
13	PDB:3k70C	0.029	0.038	2.370	1121	0.005	0.007	3k70C.pdb.gz	DNA binding to RecD: role of the 1B domain in SF1B helicase activity.
14	PDB:2a6qA	0.025	0.267	2.521	86	0.005	0.093	2a6qA.pdb.gz
15	PDB:7rroi	0.027	0.113	2.681	235	0.016	0.102	7rroi.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:5l4kW	0.033	0.173	3.429	196	0.009	0.066	5l4kW.pdb.gz
17	PDB:6am0F	0.020	0.099	3.647	178	0.004	0.034	6am0F.pdb.gz	Structure of the activated Edc1-Dcp1-Dcp2-Edc3 mRNA decapping complex with substrate analog poised for catalysis.
18	PDB:1q67B	0.017	0.102	3.879	161	0.003	0.025	1q67B.pdb.gz
19	PDB:7s1xB	0.016	0.027	3.879	871	0.004	0.007	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
20	PDB:6dc6C	0.015	0.022	4.125	996	0.001	0.002	6dc6C.pdb.gz	Crystal structure of a human ubiquitin E1-ubiquitin complex reveals conserved functional elements essential for activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GW10	0.0	3028	1507	1.000	0.991	A0A1B0GW10_HUMAN Methyl-CpG binding domain protein 5 OS=Homo sapiens OX=9606 GN=MBD5 PE=4 SV=2
2	B1AYB6	0.0	2737	1498	0.952	0.950	MBD5_MOUSE Methyl-CpG-binding domain protein 5 OS=Mus musculus OX=10090 GN=Mbd5 PE=2 SV=1
3	Q9P267	0.0	3036	1494	1.000	1.000	MBD5_HUMAN Methyl-CpG-binding domain protein 5 OS=Homo sapiens OX=9606 GN=MBD5 PE=1 SV=3
4	Q96DN6	2.50e-37	155	1003	0.048	0.072	MBD6_HUMAN Methyl-CpG-binding domain protein 6 OS=Homo sapiens OX=9606 GN=MBD6 PE=1 SV=2
5	X1WFM6	5.77e-33	142	1320	0.044	0.050	X1WFM6_DANRE Methyl-CpG-binding domain protein 6 OS=Danio rerio OX=7955 GN=mbd6 PE=4 SV=1
6	O88508	0.025	41.6	908	0.009	0.015	DNM3A_MOUSE DNA (cytosine-5)-methyltransferase 3A OS=Mus musculus OX=10090 GN=Dnmt3a PE=1 SV=2
7	Q1LZ53	0.025	41.6	908	0.009	0.015	DNM3A_RAT DNA (cytosine-5)-methyltransferase 3A OS=Rattus norvegicus OX=10116 GN=Dnmt3a PE=1 SV=1
8	Q9Y6K1	0.030	41.6	912	0.010	0.016	DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4
9	Q588C6	0.077	40.0	816	0.009	0.016	Q588C6_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=cb633 PE=1 SV=1
10	Q9UBC3	0.081	40.0	853	0.009	0.015	DNM3B_HUMAN DNA (cytosine-5)-methyltransferase 3B OS=Homo sapiens OX=9606 GN=DNMT3B PE=1 SV=1
11	J3KNX4	2.1	35.4	711	0.016	0.034	J3KNX4_HUMAN PWWP domain containing 3A, DNA repair factor OS=Homo sapiens OX=9606 GN=PWWP3A PE=1 SV=1
12	A0A0D9SGJ8	2.2	35.4	732	0.016	0.033	A0A0D9SGJ8_HUMAN PWWP domain containing 3A, DNA repair factor OS=Homo sapiens OX=9606 GN=PWWP3A PE=1 SV=1
13	Q2TAK8	2.2	35.4	710	0.016	0.034	PWP3A_HUMAN PWWP domain-containing DNA repair factor 3A OS=Homo sapiens OX=9606 GN=PWWP3A PE=1 SV=3
14	Q9FNE4	6.8	33.9	1008	0.009	0.014	PDP3_ARATH PWWP domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=PDP3 PE=1 SV=1
15	Q92949	7.7	33.1	421	0.032	0.114	FOXJ1_HUMAN Forkhead box protein J1 OS=Homo sapiens OX=9606 GN=FOXJ1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01429 MBD	1.4e+02	13.6	Methyl-CpG binding domain
2	PF00855 PWWP	0.21	23.4	PWWP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386049

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297012	0.903	Histone H2A type 1-A
2	9606.ENSP00000332790	0.903	Histone H2A type 2-B
3	9606.ENSP00000332194	0.902	Histone H2A type 2-C
4	9606.ENSP00000355656	0.902	Histone H2A type 3
5	9606.ENSP00000367022	0.902	Histone H2A type 1-C
6	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
7	9606.ENSP00000304697	0.900	Polyubiquitin-B
8	9606.ENSP00000328484	0.900	Histone H2A type 1-J
9	9606.ENSP00000341094	0.900	Histone H2A type 1-D
10	9606.ENSP00000366679	0.900	Histone H2A type 1-H
11	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
12	9606.ENSP00000441543	0.900	Polyubiquitin-C
13	9606.ENSP00000383920	0.863	Putative Polycomb group protein ASXL2
14	9606.ENSP00000335677	0.823	Forkhead box protein K2
15	9606.ENSP00000297792	0.790	Lysine-specific histone demethylase 1B
16	9606.ENSP00000417132	0.786	Ubiquitin carboxyl-terminal hydrolase BAP1
17	9606.ENSP00000364839	0.761	Putative Polycomb group protein ASXL1
18	9606.ENSP00000309555	0.753	Host cell factor 1
19	9606.ENSP00000328720	0.745	Forkhead box protein K1
20	9606.ENSP00000485525	0.737	Adenylosuccinate lyase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:1901363	0.939	heterocyclic compound binding
GO:0097159	0.939	organic cyclic compound binding
GO:0003676	0.910	nucleic acid binding
GO:0003677	0.773	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050789	0.990	regulation of biological process
GO:0050795	0.899	regulation of behavior
GO:0050794	0.885	regulation of cellular process
GO:0009987	0.803	cellular process
GO:0048518	0.788	positive regulation of biological process
GO:0032501	0.751	multicellular organismal process
GO:0032502	0.722	developmental process
GO:0048522	0.705	positive regulation of cellular process
GO:0048856	0.561	anatomical structure development
GO:0048731	0.535	system development
GO:0040008	0.472	regulation of growth
GO:0050793	0.453	regulation of developmental process
GO:0048583	0.438	regulation of response to stimulus
GO:0007399	0.372	nervous system development
GO:0010646	0.366	regulation of cell communication
GO:0048878	0.361	chemical homeostasis
GO:0023051	0.360	regulation of signaling
GO:0019222	0.313	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0030496	0.990	midbody
GO:0005737	0.718	cytoplasm
GO:0005576	0.622	extracellular region
GO:1903561	0.594	extracellular vesicle
GO:0043232	0.562	intracellular non-membrane-bounded organelle
GO:0005615	0.523	extracellular space
GO:0070062	0.485	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]