StarFunc result for job id Q9P273

User Input

>input (2699 residues)
MDVKERRPYCSLTKSRREKERRYTNSSADNEECRVPTQKSYSSSETLKAFDHDSSRLLYG
NRVKDLVHREADEFTRQGQNFTLRQLGVCEPATRRGLAFCAEMGLPHRGYSISAGSDADT
ENEAVMSPEHAMRLWGRGVKSGRSSCLSSRSNSALTLTDTEHENKSDSENEQPASNQGQS
TLQPLPPSHKQHSAQHHPSITSLNRNSLTNRRNQSPAPPAALPAELQTTPESVQLQDSWV
LGSNVPLESRHFLFKTGTGTTPLFSTATPGYTMASGSVYSPPTRPLPRNTLSRSAFKFKK
SSKYCSWKCTALCAVGVSVLLAILLSYFIAMHLFGLNWQLQQTENDTFENGKVNSDTMPT
NTVSLPSGDNGKLGGFTQENNTIDSGELDIGRRAIQEIPPGIFWRSQLFIDQPQFLKFNI
SLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRSLLETERAGRQARSVSLHEA
GFIQYLDSGIWHLAFYNDGKNAEQVSFNTIVIESVVECPRNCHGNGECVSGTCHCFPGFL
GPDCSRAACPVLCSGNGQYSKGRCLCFSGWKGTECDVPTTQCIDPQCGGRGICIMGSCAC
NSGYKGESCEEADCIDPGCSNHGVCIHGECHCSPGWGGSNCEILKTMCPDQCSGHGTYLQ
ESGSCTCDPNWTGPDCSNEICSVDCGSHGVCMGGTCRCEEGWTGPACNQRACHPRCAEHG
TCKDGKCECSQGWNGEHCTIEGCPGLCNSNGRCTLDQNGWHCVCQPGWRGAGCDVAMETL
CTDSKDNEGDGLIDCMDPDCCLQSSCQNQPYCRGLPDPQDIISQSLQSPSQQAAKSFYDR
ISFLIGSDSTHVIPGESPFNKSLASVIRGQVLTADGTPLIGVNVSFFHYPEYGYTITRQD
GMFDLVANGGASLTLVFERSPFLTQYHTVWIPWNVFYVMDTLVMKKEENDIPSCDLSGFV
RPNPIIVSSPLSTFFRSSPEDSPIIPETQVLHEETTIPGTDLKLSYLSSRAAGYKSVLKI
TMTQSIIPFNLMKVHLMVAVVGRLFQKWFPASPNLAYTFIWDKTDAYNQKVYGLSEAVVS
VGYEYESCLDLTLWEKRTAILQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFIS
QQPPVVSSIMGNGRRRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNYVRRIFPS
GNVTSVLELSSNPAHRYYLATDPVTGDLYVSDTNTRRIYRPKSLTGAKDLTKNAEVVAGT
GEQCLPFDEARCGDGGKAVEATLMSPKGMAVDKNGLIYFVDGTMIRKVDQNGIISTLLGS
NDLTSARPLTCDTSMHISQVRLEWPTDLAINPMDNSIYVLDNNVVLQITENRQVRIAAGR
PMHCQVPGVEYPVGKHAVQTTLESATAIAVSYSGVLYITETDEKKINRIRQVTTDGEISL
VAGIPSECDCKNDANCDCYQSGDGYAKDAKLSAPSSLAASPDGTLYIADLGNIRIRAVSK
NKPLLNSMNFYEVASPTDQELYIFDINGTHQYTVSLVTGDYLYNFSYSNDNDITAVTDSN
GNTLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLKSMTAQGLELVLFTYHGNSGLLATK
SDETGWTTFFDYDSEGRLTNVTFPTGVVTNLHGDMDKAITVDIESSSREEDVSITSNLSS
IDSFYTMVQDQLRNSYQIGYDGSLRIIYASGLDSHYQTEPHVLAGTANPTVAKRNMTLPG
ENGQNLVEWRFRKEQAQGKVNVFGRKLRVNGRNLLSVDFDRTTKTEKIYDDHRKFLLRIA
YDTSGHPTLWLPSSKLMAVNVTYSSTGQIASIQRGTTSEKVDYDGQGRIVSRVFADGKTW
SYTYLEKSMVLLLHSQRQYIFEYDMWDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPES
NASIITDYNEEGLLLQTAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDETAGVLKTV
NLQSDGFICTIRYRQIGPLIDRQIFRFSEDGMVNARFDYSYDNSFRVTSMQGVINETPLP
IDLYQFDDISGKVEQFGKFGVIYYDINQIISTAVMTYTKHFDAHGRIKEIQYEIFRSLMY
WITIQYDNMGRVTKREIKIGPFANTTKYAYEYDVDGQLQTVYLNEKIMWRYNYDLNGNLH
LLNPSNSARLTPLRYDLRDRITRLGDVQYRLDEDGFLRQRGTEIFEYSSKGLLTRVYSKG
SGWTVIYRYDGLGRRVSSKTSLGQHLQFFYADLTYPTRITHVYNHSSSEITSLYYDLQGH
LFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNIDFQLVIGFHG
GLYDPLTKLIHFGERDYDILAGRWTTPDIEIWKRIGKDPAPFNLYMFRNNNPASKIHDVK
DYITDVNSWLVTFGFHLHNAIPGFPVPKFDLTEPSYELVKSQQWDDIPPIFGVQQQVARQ
AKAFLSLGKMAEVQVSRRRAGGAQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLNIANED
CIKVAAVLNNAFYLENLHFTIEGKDTHYFIKTTTPESDLGTLRLTSGRKALENGINVTVS
QSTTVVNGRTRRFADVEMQFGALALHVRYGMTLDEEKARILEQARQRALARAWAREQQRV
RDGEEGARLWTEGEKRQLLSAGKVQGYDGYYVLSVEQYPELADSANNIQFLRQSEIGRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P273	1.000	1.000	0.000	2699	1.000	1.000	Q9P273.pdb.gz	TEN3_HUMAN Teneurin-3 OS=Homo sapiens OX=9606 GN=TENM3 PE=1 SV=3
2	AFDB:Q9W7R4	0.781	0.783	0.000	2694	0.821	0.823	Q9W7R4.pdb.gz	TEN3_DANRE Teneurin-3 OS=Danio rerio OX=7955 GN=tenm3 PE=2 SV=2
3	PDB:4iglA	0.059	0.085	3.348E-11	1457	0.041	0.077	4iglA.pdb.gz
4	PDB:5hxbY	0.058	0.130	3.734E-9	1080	0.047	0.119	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
5	PDB:7dvq3	0.053	0.104	6.335E-9	1193	0.044	0.100	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
6	PDB:7uknA	0.052	0.115	2.273E-8	1059	0.050	0.127	7uknA.pdb.gz	Insight into Viral Hijacking of CRL4 Ubiquitin Ligase through Structural Analysis of the pUL145-DDB1 Complex.
7	PDB:3e0cA	0.049	0.118	2.833E-8	1011	0.044	0.117	3e0cA.pdb.gz
8	PDB:2hyeA	0.054	0.116	3.094E-8	1140	0.045	0.106	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
9	PDB:5nrlP	0.054	0.105	7.804E-8	1186	0.045	0.102	5nrlP.pdb.gz	Structure of a pre-catalytic spliceosome.
10	PDB:5o9zw	0.044	0.089	9.308E-8	1140	0.040	0.096	5o9zw.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
11	PDB:7mq8LN	0.056	0.198	1.062E-7	671	0.032	0.130	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	AFDB:B7YZK8	0.093	0.158	3.554E-7	1517	0.068	0.121	B7YZK8.pdb.gz	B7YZK8_DROME Thin, isoform C OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
13	PDB:5lqwX	0.055	0.117	5.189E-7	1095	0.046	0.112	5lqwX.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
14	AFDB:B7YZW3	0.029	0.037	4.328E-5	2064	0.079	0.103	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
15	AFDB:E9Q4Y4	0.037	0.038	8.942E-3	2514	0.053	0.056	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
16	AFDB:Q54NE5	0.030	0.039	2.158E-2	1918	0.044	0.062	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
17	AFDB:P27658	0.028	0.085	3.464E-1	744	0.019	0.069	P27658.pdb.gz	CO8A1_HUMAN Collagen alpha-1(VIII) chain OS=Homo sapiens OX=9606 GN=COL8A1 PE=1 SV=2
18	AFDB:B7Z0K1	0.034	0.069	4.512E-1	1137	0.057	0.135	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
19	AFDB:P55066	0.032	0.054	7.010E-1	1268	0.051	0.108	P55066.pdb.gz	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
20	AFDB:F1QTC9	0.019	0.038	9.130E-1	859	0.030	0.093	F1QTC9.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5EGQ6	0.0	710	2684	0.218	0.219	TEN1_CAEEL Teneurin-1 OS=Caenorhabditis elegans OX=6239 GN=ten-1 PE=1 SV=1
2	H1ZUX0	0.0	712	2837	0.219	0.208	H1ZUX0_CAEEL EGF-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ten-1 PE=1 SV=1
3	H1ZUX1	0.0	711	2763	0.219	0.214	H1ZUX1_CAEEL EGF-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ten-1 PE=1 SV=1
4	O61307	0.0	1424	2731	0.298	0.294	TENM_DROME Teneurin-m OS=Drosophila melanogaster OX=7227 GN=Ten-m PE=1 SV=2
5	Q3UHK6	0.0	3837	2771	0.689	0.671	TEN4_MOUSE Teneurin-4 OS=Mus musculus OX=10090 GN=Tenm4 PE=1 SV=2
6	Q6N022	0.0	3875	2769	0.690	0.672	TEN4_HUMAN Teneurin-4 OS=Homo sapiens OX=9606 GN=TENM4 PE=1 SV=2
7	Q9DER5	0.0	3790	2802	0.657	0.633	TEN2_CHICK Teneurin-2 OS=Gallus gallus OX=9031 GN=TENM2 PE=1 SV=1
8	Q9NT68	0.0	3811	2774	0.659	0.641	TEN2_HUMAN Teneurin-2 OS=Homo sapiens OX=9606 GN=TENM2 PE=1 SV=3
9	Q9P273	0.0	5643	2699	1.000	1.000	TEN3_HUMAN Teneurin-3 OS=Homo sapiens OX=9606 GN=TENM3 PE=1 SV=3
10	Q9R1K2	0.0	3801	2774	0.659	0.641	TEN2_RAT Teneurin-2 OS=Rattus norvegicus OX=10116 GN=Tenm2 PE=1 SV=2
11	Q9UKZ4	0.0	3415	2725	0.599	0.594	TEN1_HUMAN Teneurin-1 OS=Homo sapiens OX=9606 GN=TENM1 PE=1 SV=2
12	Q9VYN8	0.0	855	3004	0.155	0.139	TENA_DROME Teneurin-a OS=Drosophila melanogaster OX=7227 GN=Ten-a PE=1 SV=2
13	Q9W6V6	0.0	3464	2705	0.604	0.603	TEN1_CHICK Teneurin-1 OS=Gallus gallus OX=9031 GN=TENM1 PE=1 SV=1
14	Q9W7R3	0.0	3716	2824	0.657	0.627	TEN4_DANRE Teneurin-4 OS=Danio rerio OX=7955 GN=tenm4 PE=2 SV=1
15	Q9W7R4	0.0	4752	2694	0.825	0.826	TEN3_DANRE Teneurin-3 OS=Danio rerio OX=7955 GN=tenm3 PE=2 SV=2
16	Q9WTS4	0.0	3398	2731	0.594	0.587	TEN1_MOUSE Teneurin-1 OS=Mus musculus OX=10090 GN=Tenm1 PE=1 SV=1
17	Q9WTS5	0.0	3806	2764	0.658	0.643	TEN2_MOUSE Teneurin-2 OS=Mus musculus OX=10090 GN=Tenm2 PE=1 SV=1
18	Q9WTS6	0.0	5553	2715	0.983	0.977	TEN3_MOUSE Teneurin-3 OS=Mus musculus OX=10090 GN=Tenm3 PE=1 SV=1
19	A0A5F8MPH8	5.64e-57	223	4356	0.040	0.025	A0A5F8MPH8_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
20	O54796	8.72e-57	222	4114	0.040	0.026	O54796_MOUSE Tenascin-X OS=Mus musculus OX=10090 GN=Tnx PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13620 CarboxypepD_reg	32	16.2	Carboxypeptidase regulatory-like domain
2	PF10049 DUF2283	5.5e+02	12.2	Protein of unknown function (DUF2283)
3	PF07974 EGF_2	9.5e-12	56.4	EGF-like domain
4	PF01436 NHL	0.00082	30.4	NHL repeat
5	PF05593 RHS_repeat	1.5e-09	49.5	RHS Repeat
6	PF06484 Ten_N	1.5e-159	543.2	Teneurin Intracellular Region
7	PF15636 Tox-GHH	4e-28	108.5	GHH signature containing HNH/Endo VII superfamily nuclease toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424226

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322270	0.785	Adhesion G protein-coupled receptor L2
2	9606.ENSP00000340688	0.768	Adhesion G protein-coupled receptor L1
3	9606.ENSP00000422533	0.768	Adhesion G protein-coupled receptor L3
4	9606.ENSP00000244314	0.729	Interferon-inducible GTPase 5
5	9606.ENSP00000365514	0.645	Zinc finger protein ZIC 2
6	9606.ENSP00000430733	0.574	CUB and sushi domain-containing protein 1
7	9606.ENSP00000381097	0.545	Ephrin type-B receptor 1
8	9606.ENSP00000354794	0.541	Zinc finger protein 521
9	9606.ENSP00000335083	0.536	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform
10	9606.ENSP00000358309	0.525	Ephrin type-A receptor 7
11	9606.ENSP00000271417	0.510	Immunoglobulin-like domain-containing receptor 2
12	9606.ENSP00000410584	0.506	CUGBP Elav-like family member 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.986	identical protein binding
GO:0046982	0.975	protein heterodimerization activity
GO:0042803	0.975	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.986	biological regulation
GO:0032501	0.982	multicellular organismal process
GO:0050794	0.982	regulation of cellular process
GO:0032502	0.979	developmental process
GO:0048856	0.967	anatomical structure development
GO:0007275	0.956	multicellular organism development
GO:0048731	0.930	system development
GO:0098609	0.891	cell-cell adhesion
GO:0009653	0.877	anatomical structure morphogenesis
GO:0007399	0.799	nervous system development
GO:0048513	0.735	animal organ development
GO:0050896	0.630	response to stimulus
GO:0007423	0.540	sensory organ development
GO:0048518	0.519	positive regulation of biological process
GO:0007154	0.501	cell communication
GO:0048522	0.473	positive regulation of cellular process
GO:0023052	0.470	signaling
GO:0048880	0.466	sensory system development
GO:0051716	0.463	cellular response to stimulus
GO:0071840	0.460	cellular component organization or biogenesis
GO:0016043	0.426	cellular component organization
GO:0098742	0.392	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0019222	0.379	regulation of metabolic process
GO:0007165	0.331	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.898	organelle
GO:0005622	0.835	intracellular anatomical structure
GO:0043229	0.653	intracellular organelle
GO:0043227	0.543	membrane-bounded organelle
GO:0005737	0.410	cytoplasm
GO:0043231	0.378	intracellular membrane-bounded organelle
GO:0005634	0.353	nucleus
GO:0005576	0.302	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]