StarFunc result for job id Q9P275

User Input

>input (1123 residues)
MPIVDKLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEALKSKY
VLLNPKTEGASRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV
GAGLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFAN
SGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTL
VHQIFGGYLRSRVKCSVCKSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAY
MCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNIRPYMSQNNG
DPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNVKVVLNQQAYVLFY
LRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGTMKKPH
TTEEIGVPISRNGSTLGLKSQNGCIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKKPA
PPQHFSPRTAQGLPGTSNSNSSRSGSQRQGSWDSRDVVLSTSPKLLATATANGHGLKGND
ESAGLDRRGSSSSSPEHSASSDSTKAPQTPRSGAAHLCDSQETNCSTAGHSKTPPSGADS
KTVKLKSPVLSNTTTEPASTMSPPPAKKLALSAKKASTLWRATGNDLRPPPPSPSSDLTH
PMKTSHPVVASTWPVHRARAVSPAPQSSSRLQPPFSPHPTLLSSTPKPPGTSEPRSCSSI
STALPQVNEDLVSLPHQLPEASEPPQSPSEKRKKTFVGEPQRLGSETRLPQHIREATAAP
HGKRKRKKKKRPEDTAASALQEGQTQRQPGSPMYRREGQAQLPAVRRQEDGTQPQVNGQQ
VGCVTDGHHASSRKRRRKGAEGLGEEGGLHQDPLRHSCSPMGDGDPEAMEESPRKKKKKK
RKQETQRAVEEDGHLKCPRSAKPQDAVVPESSSCAPSANGWCPGDRMGLSQAPPVSWNGE
RESDVVQELLKYSSDKAYGRKVLTWDGKMSAVSQDAIEDSRQARTETVVDDWDEEFDRGK
EKKIKKFKREKRRNFNAFQKLQTRRNFWSVTHPAKAASLSYRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R8V6	0.314	0.314	0.000	1123	1.000	1.000	A0A024R8V6.pdb.gz
2	AFDB:B1AQJ2	0.367	0.374	0.000	1098	0.732	0.749	B1AQJ2.pdb.gz	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
3	AFDB:E7F4C0	0.331	0.336	4.021E-96	1104	0.515	0.524	E7F4C0.pdb.gz	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
4	AFDB:Q9H9J4	0.298	0.253	1.325E-65	1324	0.326	0.276	Q9H9J4.pdb.gz	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
5	AFDB:B2RQC2	0.303	0.258	5.429E-65	1324	0.321	0.272	B2RQC2.pdb.gz	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
6	PDB:3mhsA	0.252	0.603	7.011E-28	455	0.084	0.207	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
7	PDB:5cvnB	0.249	0.827	2.740E-26	321	0.078	0.274	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
8	PDB:4fjcE	0.235	0.578	2.927E-25	434	0.081	0.210	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
9	PDB:7ay1D	0.249	0.769	3.919E-24	341	0.069	0.229	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
10	PDB:8a9kD	0.219	0.806	9.661E-24	285	0.068	0.267	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
11	PDB:5k16B	0.241	0.767	1.517E-23	328	0.076	0.259	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
12	PDB:4wa6D	0.225	0.586	6.213E-23	415	0.075	0.202	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
13	PDB:7yxxA	0.236	0.153	5.007E-22	1754	0.079	0.051	7yxxA.pdb.gz
14	PDB:7w3ax	0.231	0.503	3.043E-21	494	0.068	0.154	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
15	PDB:5k1bA	0.210	0.825	5.349E-21	264	0.073	0.311	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
16	AFDB:Q70CQ4	0.248	0.207	1.246E-19	1352	0.203	0.169	Q70CQ4.pdb.gz	UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens OX=9606 GN=USP31 PE=2 SV=2
17	AFDB:P15975	0.220	0.231	1.260E-12	1069	0.150	0.157	P15975.pdb.gz	UBP53_MOUSE Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Mus musculus OX=10090 GN=Usp53 PE=1 SV=2
18	AFDB:Q70EK8	0.213	0.222	2.936E-12	1073	0.134	0.141	Q70EK8.pdb.gz	UBP53_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 53 OS=Homo sapiens OX=9606 GN=USP53 PE=1 SV=2
19	AFDB:Q9I7F7	0.065	0.057	1.722E-3	1337	0.138	0.116	Q9I7F7.pdb.gz	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
20	AFDB:O09000	0.057	0.048	7.055E-3	1398	0.143	0.115	O09000.pdb.gz	NCOA3_MOUSE Nuclear receptor coactivator 3 OS=Mus musculus OX=10090 GN=Ncoa3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AQJ2	0.0	1480	1098	0.728	0.745	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
2	E9PEW0	0.0	1137	548	0.483	0.989	E9PEW0_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=2
3	Q9P275	0.0	2321	1123	1.000	1.000	UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4
4	B2RQC2	3.46e-175	552	1324	0.221	0.187	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
5	Q9H9J4	5.27e-174	549	1324	0.220	0.187	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
6	Q6QN14	2.88e-124	388	398	0.159	0.450	U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens OX=9606 GN=USP17L6P PE=1 SV=2
7	Q0WX57	3.07e-123	390	530	0.159	0.338	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
8	Q6R6M4	2.86e-118	377	530	0.156	0.330	U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens OX=9606 GN=USP17L2 PE=1 SV=2
9	E9Q9U0	6.41e-95	313	468	0.134	0.321	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
10	G5E8G2	1.40e-94	314	545	0.138	0.284	U17PD_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein D OS=Mus musculus OX=10090 GN=Usp17ld PE=1 SV=1
11	G5E8I7	4.65e-94	313	545	0.137	0.283	U17LC_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein C OS=Mus musculus OX=10090 GN=Usp17lc PE=1 SV=1
12	O74442	1.57e-93	308	457	0.151	0.372	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
13	Q7M764	3.10e-93	310	540	0.132	0.274	U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus OX=10090 GN=Usp17le PE=3 SV=2
14	Q61068	6.42e-92	306	526	0.132	0.281	U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus OX=10090 GN=Usp17la PE=1 SV=1
15	Q9VRP5	4.99e-72	262	1038	0.135	0.146	UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster OX=7227 GN=scny PE=1 SV=3
16	Q9FPS9	5.46e-67	246	924	0.116	0.141	UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=2
17	F4I642	1.92e-66	244	928	0.115	0.139	F4I642_ARATH Ubiquitin-specific protease 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=1
18	Q9SB51	2.75e-61	230	1008	0.108	0.120	UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana OX=3702 GN=UBP16 PE=1 SV=1
19	Q9FIQ1	2.78e-55	208	732	0.114	0.175	UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana OX=3702 GN=UBP21 PE=2 SV=1
20	Q385P1	4.61e-41	165	765	0.110	0.161	Q385P1_TRYB2 Ubiquitin carboxyl-terminal hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2940 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00443 UCH	2e-48	176.9	Ubiquitin carboxyl-terminal hydrolase
2	PF13423 UCH_1	7.2e-14	63.7	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000441214

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377944	0.849	U3 small nucleolar RNA-associated protein 14 homolog A
2	9606.ENSP00000225296	0.758	Putative ATP-dependent RNA helicase DHX33
3	9606.ENSP00000003302	0.722	Ubiquitin carboxyl-terminal hydrolase 28
4	9606.ENSP00000404179	0.669	Dedicator of cytokinesis protein 4
5	9606.ENSP00000309163	0.638	CAAX prenyl protease 2
6	9606.ENSP00000285420	0.605	[Isoform 1]: Deubiquitinating enzyme that may play a role in the ubiquitin-dependent regulation of protein synthesis, downstream of mTORC1 . May associate with the protein synthesis initiation complex and modify its ubiquitination to repress translation . May also repress DNA synthesis and modify different cellular targets thereby regulating cell growth and proliferation . May also play a role in proteasome assembly and function
7	9606.ENSP00000229268	0.603	Ubiquitin carboxyl-terminal hydrolase 5
8	9606.ENSP00000263966	0.595	Ubiquitin carboxyl-terminal hydrolase 13
9	9606.ENSP00000383044	0.594	Ubiquitin carboxyl-terminal hydrolase 25
10	9606.ENSP00000307674	0.582	Soluble calcium-activated nucleotidase 1
11	9606.ENSP00000296930	0.577	Nucleophosmin
12	9606.ENSP00000257548	0.573	Ubiquitin carboxyl-terminal hydrolase 30
13	9606.ENSP00000479618	0.556	Myc proto-oncogene protein
14	9606.ENSP00000281708	0.541	F-box/WD repeat-containing protein 7
15	9606.ENSP00000392025	0.533	Ubiquitin carboxyl-terminal hydrolase CYLD
16	9606.ENSP00000349508	0.519	Chromodomain-helicase-DNA-binding protein 4
17	9606.ENSP00000358151	0.515	Histone H2B type 2-E
18	9606.ENSP00000221801	0.509	rRNA 2'-O-methyltransferase fibrillarin
19	9606.ENSP00000164305	0.504	GPI mannosyltransferase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0003723	0.996	RNA binding
GO:0004175	0.435	endopeptidase activity
GO:0004197	0.430	cysteine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0036211	0.986	protein modification process
GO:0050794	0.970	regulation of cellular process
GO:0070647	0.969	protein modification by small protein conjugation or removal
GO:0006508	0.968	proteolysis
GO:0070646	0.958	protein modification by small protein removal
GO:0016579	0.954	protein deubiquitination
GO:0019222	0.871	regulation of metabolic process
GO:0060255	0.790	regulation of macromolecule metabolic process
GO:0009987	0.777	cellular process
GO:0051171	0.669	regulation of nitrogen compound metabolic process
GO:0031323	0.663	regulation of cellular metabolic process
GO:0080090	0.661	regulation of primary metabolic process
GO:0019219	0.551	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.550	positive regulation of biological process
GO:0010468	0.514	regulation of gene expression
GO:0048519	0.487	negative regulation of biological process
GO:0051252	0.470	regulation of RNA metabolic process
GO:0048522	0.463	positive regulation of cellular process
GO:0031647	0.411	regulation of protein stability
GO:0048523	0.399	negative regulation of cellular process
GO:0009892	0.313	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	0.999	nucleolus
GO:0005737	0.996	cytoplasm
GO:0016604	0.994	nuclear body
GO:0016607	0.961	nuclear speck
GO:0005829	0.547	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.
EC:3.4.22.-	0.430	Cysteine endopeptidases.

[back to server]