StarFunc result for job id Q9P278

User Input

>input (1114 residues)
MAPTLLQKLFNKRGSSGSSAAASAQGRAPKEGPAFSWSCSEFDLNEIRLIVYQDCDRRGR
QVLFDSKAVQKIEEVTAQKTEDVPIKISAKCCQGSSSVSSSSSSSISSHSSSGGSSHHAK
EQLPKYQYTRPASDVNMLGEMMFGSVAMSYKGSTLKIHYIRSPPQLMISKVFSARMGSFC
GSTNNLQDSFEYINQDPNLGKLNTNQNSLGPCRTGSNLAHSTPVDMPSRGQNEDRDSGIA
RSASLSSLLITPFPSPSSSTSSSSSYQRRWLRSQTTSLENGIIPRRSTDETFSLAEETCS
SNPAMVRRKKIAISIIFSLCEKEEAQRNFQDFFFSHFPLFESHMNRLKSAIEKAMISCRK
IAESSLRVQFYVSRLMEALGEFRGTIWNLYSVPRIAEPVWLTMMSGTLEKNQLCQRFLKE
FTLLIEQINKNQFFAALLTAVLTYHLAWVPTVMPVDHPPIKAFSEKRTSQSVNMLAKTHP
YNPLWAQLGDLYGAIGSPVRLTRTVVVGKQKDLVQRILYVLTYFLRCSELQENQLTWSGN
HGEGDQVLNGSKIITALEKGEVEESEYVVITVRNEPALVPPILPPTAAERHNPWPTGFPE
CPEGTDSRDLGLKPDKEANRRPEQGSEACSAGCLGPASDASWKPQNAFCGDEKNKEAPQD
GSSRLPSCEVLGAGMKMDQQAVCELLKVEMPTRLPDRSVAWPCPDRHLREKPSLEKVTFQ
IGSFASPESDFESRMKKMEERVKACGPSLEASEAADVAQDPQVSRSPFKPGFQENVCCPQ
NRLSEGDEGESDKGFAEDRGSRNDMAADIAGQLSHAADLGTASHGAGGTGGRRLEATRGL
YVKAAEGPVLEPVAPRCVQRGPGLVAGANIPCGDDNKKANFRTEGDIPRNESSDSALGDS
DDEACASAMLDLGHGGDRTGGSLEVELPLPRSQSISTQNVRNFGRSLLAGYCPTYMPDLV
LHGTGSDEKLKQCLVADLVHTVHHPVLDEPIAEAVCIIADTDKWSVQVATSQRKVTDNMK
LGQDVLVSSQVSSLLQSILQLYKLHLPADFCIMHLEDRLQEMYLKSKMLSEYLRGHTRVH
VKELGVVLGIESNDLPLLTAIASTHSPYVAQILL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80TD3	0.613	0.616	0.000	1108	0.786	0.791	Q80TD3.pdb.gz	FNIP2_MOUSE Folliculin-interacting protein 2 OS=Mus musculus OX=10090 GN=Fnip2 PE=1 SV=2
2	AFDB:Q9P278	1.000	1.000	0.000	1114	1.000	1.000	Q9P278.pdb.gz	FNIP2_HUMAN Folliculin-interacting protein 2 OS=Homo sapiens OX=9606 GN=FNIP2 PE=1 SV=2
3	AFDB:Q8TF40	0.503	0.483	2.722E-85	1166	0.530	0.506	Q8TF40.pdb.gz	FNIP1_HUMAN Folliculin-interacting protein 1 OS=Homo sapiens OX=9606 GN=FNIP1 PE=1 SV=3
4	PDB:6ulgN	0.384	0.854	1.579E-40	483	0.392	0.905	6ulgN.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
5	PDB:6nzdI	0.330	0.916	8.006E-29	388	0.338	0.969	6nzdI.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
6	PDB:7o2wA	0.116	0.271	7.482E-3	418	0.035	0.093	7o2wA.pdb.gz
7	PDB:6lt0C	0.108	0.280	1.918E-2	385	0.028	0.081	6lt0C.pdb.gz
8	PDB:7mgeC	0.100	0.265	1.199E-1	365	0.027	0.082	7mgeC.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
9	AFDB:B4UN32	0.046	0.044	1.663E-1	1208	0.088	0.081	B4UN32.pdb.gz	AWP3B_CANGA Adhesin AWP3b OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP3b PE=1 SV=2
10	AFDB:Q9TW45	0.047	0.045	1.929E-1	1192	0.105	0.098	Q9TW45.pdb.gz	PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans OX=6239 GN=par-1 PE=1 SV=1
11	AFDB:P49750	0.042	0.027	2.130E-1	2146	0.119	0.062	P49750.pdb.gz	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4
12	AFDB:P34250	0.041	0.041	2.597E-1	1132	0.110	0.109	P34250.pdb.gz	SEG2_YEAST Eisosome protein SEG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEG2 PE=1 SV=1
13	PDB:6nzdH	0.077	0.192	2.926E-1	387	0.022	0.062	6nzdH.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
14	PDB:6ulgL	0.084	0.184	3.074E-1	458	0.021	0.050	6ulgL.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
15	AFDB:Q9NPG3	0.054	0.053	3.496E-1	1134	0.099	0.097	Q9NPG3.pdb.gz	UBN1_HUMAN Ubinuclein-1 OS=Homo sapiens OX=9606 GN=UBN1 PE=1 SV=2
16	AFDB:Q3BBV0	0.040	0.038	3.673E-1	1214	0.115	0.105	Q3BBV0.pdb.gz	NBPF1_HUMAN Neuroblastoma breakpoint family member 1 OS=Homo sapiens OX=9606 GN=NBPF1 PE=1 SV=2
17	AFDB:Q9VWL7	0.037	0.032	3.673E-1	1317	0.130	0.110	Q9VWL7.pdb.gz	Q9VWL7_DROME Rho GTPase activating protein at 18B, isoform C OS=Drosophila melanogaster OX=7227 GN=RhoGAP18B PE=4 SV=2
18	PDB:8dhbJ	0.072	0.182	4.349E-1	361	0.020	0.061	8dhbJ.pdb.gz	Structural basis for FLCN RagC GAP activation in MiT-TFE substrate-selective mTORC1 regulation.
19	PDB:6qw663	0.023	0.261	3.847	85	0.007	0.094	6qw663.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
20	PDB:7qqmA	0.042	0.071	4.248	413	0.021	0.056	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68FD7	0.0	983	1165	0.545	0.521	FNIP1_MOUSE Folliculin-interacting protein 1 OS=Mus musculus OX=10090 GN=Fnip1 PE=1 SV=1
2	Q80TD3	0.0	1624	1108	0.785	0.789	FNIP2_MOUSE Folliculin-interacting protein 2 OS=Mus musculus OX=10090 GN=Fnip2 PE=1 SV=2
3	Q8TF40	0.0	679	1166	0.330	0.316	FNIP1_HUMAN Folliculin-interacting protein 1 OS=Homo sapiens OX=9606 GN=FNIP1 PE=1 SV=3
4	Q9P278	0.0	2313	1114	1.000	1.000	FNIP2_HUMAN Folliculin-interacting protein 2 OS=Homo sapiens OX=9606 GN=FNIP2 PE=1 SV=2
5	E9PCH4	8.00e-14	79.0	1651	0.037	0.025	E9PCH4_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 PE=4 SV=1
6	Q5BEM5	0.60	36.6	952	0.030	0.035	Q5BEM5_EMENI Spindle pole body component OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01005 PE=3 SV=1
7	A0A8I5YBV3	1.1	35.8	2096	0.023	0.012	A0A8I5YBV3_RAT Mediator of RNA polymerase II transcription subunit 13 OS=Rattus norvegicus OX=10116 GN=Med13 PE=3 SV=1
8	F1LXU0	1.2	35.8	2171	0.023	0.012	F1LXU0_RAT Mediator of RNA polymerase II transcription subunit 13 OS=Rattus norvegicus OX=10116 GN=Med13 PE=1 SV=3
9	Q5SWW4	1.9	35.0	2171	0.022	0.012	MED13_MOUSE Mediator of RNA polymerase II transcription subunit 13 OS=Mus musculus OX=10090 GN=Med13 PE=1 SV=1
10	Q9VLT5	4.2	34.3	5322	0.020	0.004	POE_DROME Protein purity of essence OS=Drosophila melanogaster OX=7227 GN=poe PE=1 SV=1
11	Q9UHV7	4.3	33.9	2174	0.023	0.012	MED13_HUMAN Mediator of RNA polymerase II transcription subunit 13 OS=Homo sapiens OX=9606 GN=MED13 PE=1 SV=3
12	Q9P6K4	4.8	33.9	842	0.016	0.021	YLF7_SCHPO Uncharacterized protein C30C2.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC30C2.07 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14638 FNIP_C	3.2e-68	240.7	Folliculin-interacting protein C-terminus
2	PF14637 FNIP_M	2.6e-79	277.9	Folliculin-interacting protein middle domain
3	PF14636 FNIP_N	5.9e-30	116.6	Folliculin-interacting protein N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264433

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000285071	0.999	Folliculin
2	9606.ENSP00000362092	0.994	Ras-related GTP-binding protein C
3	9606.ENSP00000369899	0.988	Ras-related GTP-binding protein A
4	9606.ENSP00000424183	0.986	Ragulator complex protein LAMTOR3
5	9606.ENSP00000343118	0.984	Ragulator complex protein LAMTOR4
6	9606.ENSP00000256644	0.982	Ragulator complex protein LAMTOR5
7	9606.ENSP00000278671	0.981	Ragulator complex protein LAMTOR1
8	9606.ENSP00000357288	0.980	Ragulator complex protein LAMTOR2
9	9606.ENSP00000358423	0.956	Ras-related GTP-binding protein D
10	9606.ENSP00000262850	0.955	Ras-related GTP-binding protein B
11	9606.ENSP00000379203	0.911	V-type proton ATPase subunit C 1
12	9606.ENSP00000285393	0.908	V-type proton ATPase subunit d 2
13	9606.ENSP00000302194	0.907	V-type proton ATPase subunit G 2
14	9606.ENSP00000363162	0.907	V-type proton ATPase subunit G 1
15	9606.ENSP00000281087	0.906	V-type proton ATPase subunit G 3
16	9606.ENSP00000290949	0.905	V-type proton ATPase subunit d 1
17	9606.ENSP00000272238	0.903	V-type proton ATPase subunit C 2
18	9606.ENSP00000265686	0.902	V-type proton ATPase 116 kDa subunit a isoform 3
19	9606.ENSP00000273398	0.902	V-type proton ATPase catalytic subunit A
20	9606.ENSP00000421985	0.902	Folliculin-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051087	1.000	chaperone binding
GO:0042030	1.000	ATPase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0050896	0.979	response to stimulus
GO:0048522	0.957	positive regulation of cellular process
GO:0051716	0.951	cellular response to stimulus
GO:0060255	0.936	regulation of macromolecule metabolic process
GO:0031323	0.918	regulation of cellular metabolic process
GO:0048519	0.891	negative regulation of biological process
GO:0007154	0.851	cell communication
GO:0080090	0.848	regulation of primary metabolic process
GO:0048523	0.845	negative regulation of cellular process
GO:0051171	0.818	regulation of nitrogen compound metabolic process
GO:0051246	0.779	regulation of protein metabolic process
GO:0023052	0.584	signaling
GO:0009893	0.576	positive regulation of metabolic process
GO:0048583	0.524	regulation of response to stimulus
GO:0007165	0.484	signal transduction
GO:0010604	0.469	positive regulation of macromolecule metabolic process
GO:0032006	0.467	regulation of TOR signaling
GO:0033554	0.417	cellular response to stress
GO:0009892	0.373	negative regulation of metabolic process
GO:0031325	0.340	positive regulation of cellular metabolic process
GO:0010468	0.324	regulation of gene expression
GO:0035556	0.320	intracellular signal transduction
GO:0009967	0.311	positive regulation of signal transduction
GO:0071704	0.307	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005829	0.968	cytosol
GO:0016020	0.966	membrane
GO:0043229	0.964	intracellular organelle
GO:0031090	0.923	organelle membrane
GO:0000323	0.905	lytic vacuole
GO:0005764	0.904	lysosome
GO:0043232	0.893	intracellular non-membrane-bounded organelle
GO:0005765	0.887	lysosomal membrane
GO:0032991	0.798	protein-containing complex
GO:0005856	0.670	cytoskeleton
GO:0015630	0.656	microtubule cytoskeleton
GO:0005815	0.648	microtubule organizing center
GO:0005813	0.632	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]