StarFunc result for job id Q9P281

User Input

>input (2639 residues)
MDGRDFAPPPHLLSERGSLGHRSAAAAARLAPAGPAAQPPAHFQPGKYFPSPLPMASHTA
SSRLMGSSPASSFMGSFLTSSLGSAASTHPSGPSSSPPEQAYRGSHPTTSQIWFSHSHEA
PGYPRFSGSLASTFLPVSHLDHHGNSNVLYGQHRFYGTQKDNFYLRNLPPQPTLLPANHN
FPSVARAAPAHPMGSCSRDRDRGEAGSLQKGPKDFDRFLVGKELGREKAGKAAEGKERPA
AEEDGGKERHKLVLPVPADGHCREGGPAPRGACEGRPKHLTSCLLNTKVLNGEMGRAALA
SCAGGMLGRPGTGVVTSGRCAKEAAGPPEPGPAFSECLERRQMLHHTASYAGPPPPLSTA
AGSFPCLQLHGGPDGLCPLQDKAPRDLKASGPTFVPSVGHLADKGRPFQAAEACAVAGEG
KDRHLEGTMAPDHAAPYGVSYAHLKAEGKGERRPGGFEAALNPRLKGLDYLSSAGPEASF
PGLPKSGLDKSGYFELPTSSQDCARPGHQDPLGGKAPQACCTLDKTVGKEAPAGPPGAQK
VARIRHQQHLMAAEVEQGGIGAEAKRKSLELASLGYSGPHLPPWGVQAGQGTAMAISEER
KAGAYLDPFGSGLQQAALLPQELPAPPDEVSAMKNLLKYSSQALVVGQKAPLVGLGGLKA
SCIQQEAKFLSSKGPGQSERPDCARSREHDTTHGDGEVRQPPVGIAVALARQKDTVSRSE
AAYGTNTARQGRAAPAFKGGGGPRSTHALDLEAEEERTRLCDDRLGLASRELLLQDSKDR
VEFARIHPPSSCPGDLAPHLMMQSGQLGGDPAPHTHPHPPWLPRTRSPSLWMGGHSYGLG
HPALHQNLPPGFPASVAGPVPSVFPLPQDAPTQLVILPSEPTPHSAPHALADVMDQASLW
PPMYGGRGPASHMQHPGQLPVYSRPQLLRQQELYALQQQRAAQFQRKPEDQHLDLEEPAQ
EKAPKSTHKPVALTPTAPGAPSPAAGPTKLPPCCHPPDPKPPASSPTPPPRPSAPCTLNV
CPASSPGPGSRVRSAEEKNGEGQQSTADIITSEPVARAHSVAHAGLEFLASNDPSTSASQ
SFGITDLPPGYLRPMAGLGFSLPSDVHSSNLEDPETMQTTAPGAQPEPTRTFLPGEPPPC
SPRSLEEPGLLSGAREATQDLAATPYPTERGPQGKAADPSPLEGLQELQCAALLEAGGPE
ATGQAHSTQGGAREERSREEGEQGPSSGASSQVLEQRAGSPGALEDEGEQPAPEEDELEE
DELGQQSMEDSEEDCGGAPDNSHPPRALPGLDALVAATINLGDLPSDSPPDPQPPAASGP
PSTVPLPHSSGIHGIALLSELADLAIQRQRSERTVPEEEEDVLAFNLQHLATLATAWSLV
EAAGLDSSTAPAQPPTANPCSGPRLTPRMQILQRKDTWTPKTKPVCPLKAAIDRLDTQEV
GMRVRLAELQRRYKEKQRELARLQRKHDHERDESSRSPARRGPGRPRKRKHSSSLPAPRP
TGPLPRSDGKKVKAVRTSLGLLCAELRGGSGGEPAKKRSKLERSVYAGLQTASVEKAQCK
KSSCQGGLAPSVAHRVAQLKPKVKSKGLPTGLSSFQQKEATPGGRIREKLSRAKSAKVSG
ATRHPQPKGHGSRETPRCPAQPSVAASQEAGSGYDSEDCEGLLGTEAPPREAGLLLHTGA
SVAVLGPSPSSVVKMEANQKAKKKKERQGLLGACRLSSPESEVKIKRRSVKAKVGTTLER
APGQRPPGALGKKKAKGKAKGSLRAEPGATPSRDALFNPSRAFACREEGSQLASERLKRA
TRKGTVLQPVLRRKNGALSITLATRNAKAILGKGRKLSKVKHKAGKQGKGRAVSRLLESF
AVEEDFEFDDNSSFSEEEEDEEEEEEDSGPLSAEQSAALARSCAIHKEDLRDGLPVLIPK
EDSLLYAGSVRTLQPPDIYSIVIEGERGNRQRIYSLEQLLQEAVLDVRPQSSRYLPPGTR
VCAYWSQKSRCLYPGNVVRGASGDEDEDLDSVVVEFDDGDTGHIAVSNVRLLPPDFKIQC
TEPSPALLVSSSCRRTKKVSSEAPPPSEAATPSLSPKAQDGPEALKTPGKKSISKDKAGK
AELLTSGAKSPTGASDHFLGRRGSPLLSWSAVAQTKRKAVAAASKGPGVLQNLFQLNGSS
KKLRAREALFPVHSVATPIFGNGFRADSFSSLASSYAPFVGGTGPGLPRGAHKLLRAKKA
ERVEAEKGGRRRAGGEFLVKLDHEGVTSPKNKTCKALLMGDKDFSPKLGRPLPSPSYVHP
ALVGKDKKGRAPIPPLPMGLALRKYAGQAEFPLPYDSDCHSSFSDEDEDGPGLAAGVPSR
FLARLSVSSSSSGSSTSSSSGSVSTSSLCSSDNEDSSYSSDDEDPALLLQTCLTHPVPTL
LAQPEALRSKGSGPHAHAQRCFLSRATVAGTGAGSGPSSSSKSKLKRKEALSFSKAKELS
RRQRPPSVENRPKISAFLPARQLWKWSGNPTQRRGMKGKARKLFYKAIVRGEETLRVGDC
AVFLSAGRPNLPYIGRIESMWESWGSNMVVKVKWFYHPEETKLGKRQCDGKNALYQSCHE
DENDVQTISHKCQVVAREQYEQMARSRKCQDRQDLYYLAGTYDPTTGRLVTADGVPILC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3LHL9	0.088	0.131	2.122E-39	1658	0.153	0.243	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
2	AFDB:Q9VWC0	0.063	0.065	6.209E-12	2529	0.153	0.160	Q9VWC0.pdb.gz	Q9VWC0_DROME Histone gene-specific epigenetic repressor in late S phase, isoform A OS=Drosophila melanogaster OX=7227 GN=Hers PE=4 SV=2
3	PDB:5z8lA	0.047	0.516	1.473E-10	204	0.017	0.216	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
4	AFDB:F4JP43	0.044	0.055	3.238E-9	2037	0.127	0.165	F4JP43.pdb.gz	F4JP43_ARATH G2484-1 protein OS=Arabidopsis thaliana OX=3702 GN=G2484-1 PE=1 SV=1
5	PDB:7aoaD	0.038	0.278	1.893E-7	343	0.010	0.076	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
6	AFDB:F1M842	0.041	0.051	1.426E-6	1972	0.118	0.158	F1M842.pdb.gz	F1M842_RAT Tumor protein p53 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53bp1 PE=1 SV=3
7	AFDB:Q12888	0.037	0.047	8.658E-6	1972	0.105	0.141	Q12888.pdb.gz	TP53B_HUMAN TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2
8	AFDB:O88491	0.030	0.031	1.157E-4	2588	0.135	0.138	O88491.pdb.gz	NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
9	AFDB:D4AC33	0.038	0.046	1.534E-4	1920	0.097	0.133	D4AC33.pdb.gz	D4AC33_RAT Methylcytosine dioxygenase TET OS=Rattus norvegicus OX=10116 GN=Tet2 PE=3 SV=2
10	AFDB:Q9H2Y7	0.037	0.046	1.717E-4	1883	0.095	0.133	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
11	PDB:3mp8A	0.040	0.187	1.734E-4	513	0.009	0.049	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
12	AFDB:Q8NFU7	0.030	0.035	3.192E-4	2136	0.100	0.124	Q8NFU7.pdb.gz	TET1_HUMAN Methylcytosine dioxygenase TET1 OS=Homo sapiens OX=9606 GN=TET1 PE=1 SV=2
13	PDB:7abi7	0.027	0.201	5.665E-4	236	0.007	0.081	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
14	AFDB:Q62417	0.033	0.059	8.323E-4	1290	0.082	0.168	Q62417.pdb.gz	SRBS1_MOUSE Sorbin and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sorbs1 PE=1 SV=2
15	PDB:5ikjA	0.031	0.157	1.958E-3	448	0.006	0.038	5ikjA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
16	PDB:7azyx	0.031	0.235	1.576E-2	252	0.009	0.099	7azyx.pdb.gz	Context-specific action of macrolide antibiotics on the eukaryotic ribosome.
17	PDB:3j79D	0.032	0.234	3.469E-2	247	0.008	0.089	3j79D.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
18	PDB:3j9zLN	0.031	0.194	3.670E-2	272	0.006	0.055	3j9zLN.pdb.gz	Activation of GTP hydrolysis in mRNA-tRNA translocation by elongation factor G.
19	PDB:4v6wCA	0.030	0.201	3.670E-2	253	0.006	0.063	4v6wCA.pdb.gz	Structures of the human and Drosophila 80S ribosome.
20	PDB:5datS4	0.028	0.162	4.108E-2	260	0.007	0.069	5datS4.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15417	2.89e-85	316	2968	0.055	0.049	TNC18_HUMAN Trinucleotide repeat-containing gene 18 protein OS=Homo sapiens OX=9606 GN=TNRC18 PE=1 SV=3
2	H9KVB4	3.17e-85	316	2968	0.055	0.049	H9KVB4_HUMAN Trinucleotide repeat containing 18 OS=Homo sapiens OX=9606 GN=TNRC18 PE=1 SV=1
3	Q3LHL9	5.52e-49	196	1658	0.036	0.057	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
4	Q2MGL2	2.07e-11	72.4	1456	0.017	0.031	Q2MGL2_DROME Histone gene-specific epigenetic repressor in late S phase, isoform D OS=Drosophila melanogaster OX=7227 GN=Hers PE=4 SV=1
5	Q9VWC0	2.15e-11	72.8	2529	0.017	0.018	Q9VWC0_DROME Histone gene-specific epigenetic repressor in late S phase, isoform A OS=Drosophila melanogaster OX=7227 GN=Hers PE=4 SV=2
6	Q86NN1	2.21e-11	72.8	2201	0.017	0.020	Q86NN1_DROME GH07949p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Hers PE=2 SV=1
7	Q9VWC2	4.18e-11	71.6	1280	0.017	0.035	Q9VWC2_DROME Histone gene-specific epigenetic repressor in late S phase, isoform C OS=Drosophila melanogaster OX=7227 GN=Hers PE=4 SV=2
8	M9NES5	5.09e-11	71.2	1139	0.017	0.040	M9NES5_DROME Histone gene-specific epigenetic repressor in late S phase, isoform H OS=Drosophila melanogaster OX=7227 GN=Hers PE=4 SV=1
9	Q95U13	1.07e-10	70.1	967	0.017	0.047	Q95U13_DROME GH14389p OS=Drosophila melanogaster OX=7227 GN=Hers PE=2 SV=1
10	F4JL28	1.03e-09	63.5	234	0.017	0.192	EBS_ARATH Chromatin remodeling protein EBS OS=Arabidopsis thaliana OX=3702 GN=EBS PE=1 SV=1
11	Q8TBE0	9.98e-09	63.5	780	0.012	0.041	BAHD1_HUMAN Bromo adjacent homology domain-containing 1 protein OS=Homo sapiens OX=9606 GN=BAHD1 PE=1 SV=2
12	Q9FEN9	2.39e-08	59.3	228	0.016	0.189	SHL_ARATH Chromatin remodeling protein SHL OS=Arabidopsis thaliana OX=3702 GN=SHL PE=1 SV=1
13	P13864	4.91e-04	48.1	1620	0.009	0.014	DNMT1_MOUSE DNA (cytosine-5)-methyltransferase 1 OS=Mus musculus OX=10090 GN=Dnmt1 PE=1 SV=5
14	P53236	0.003	45.8	928	0.008	0.022	RSC1_YEAST Chromatin structure-remodeling complex subunit RSC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSC1 PE=1 SV=1
15	Q06488	0.003	45.4	889	0.008	0.024	RSC2_YEAST Chromatin structure-remodeling complex subunit RSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSC2 PE=1 SV=1
16	P26358	0.004	45.1	1616	0.011	0.018	DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2
17	Q5SMU7	0.004	45.4	814	0.009	0.028	ORC1_ORYSJ Origin of replication complex subunit 1 OS=Oryza sativa subsp. japonica OX=39947 GN=ORC1 PE=2 SV=1
18	F4JCS8	0.005	45.1	1613	0.011	0.018	F4JCS8_ARATH Protein SUO OS=Arabidopsis thaliana OX=3702 GN=SUO PE=1 SV=1
19	Q8RXT5	0.006	44.7	587	0.009	0.041	AIPP3_ARATH ASI1-immunoprecipitated protein 3 OS=Arabidopsis thaliana OX=3702 GN=AIPP3 PE=1 SV=1
20	Q9LYE3	0.12	40.0	650	0.008	0.031	ASI1_ARATH Protein ANTI-SILENCING 1 OS=Arabidopsis thaliana OX=3702 GN=ASI1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01426 BAH	1.2e-12	59.2	BAH domain
2	PF09863 DUF2090	50	14.4	Uncharacterized protein conserved in bacteria (DUF2090)
3	PF15057 DUF4537	9	17.7	Domain of unknown function (DUF4537)
4	PF11923 NFACT-C	3e+02	12.7	NFACT protein C-terminal domain
5	PF18115 Tudor_3	0.21	22.8	DNA repair protein Crb2 Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000462154

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307183	0.670	Inhibitor of growth protein 2
2	9606.ENSP00000368767	0.660	Aspartyl/asparaginyl beta-hydroxylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.539	nucleic acid binding
GO:0003824	0.415	catalytic activity
GO:0003677	0.302	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.953	regulation of cellular process
GO:0060255	0.936	regulation of macromolecule metabolic process
GO:0048519	0.935	negative regulation of biological process
GO:0010468	0.906	regulation of gene expression
GO:0048523	0.866	negative regulation of cellular process
GO:2001141	0.828	regulation of RNA biosynthetic process
GO:0009987	0.480	cellular process
GO:1903506	0.424	regulation of nucleic acid-templated transcription
GO:0009892	0.400	negative regulation of metabolic process
GO:0006355	0.395	regulation of DNA-templated transcription
GO:0010605	0.370	negative regulation of macromolecule metabolic process
GO:0048518	0.334	positive regulation of biological process
GO:0032502	0.314	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0012505	0.997	endomembrane system
GO:0016020	0.974	membrane
GO:0031090	0.936	organelle membrane
GO:0005829	0.797	cytosol
GO:0005739	0.768	mitochondrion
GO:0031967	0.736	organelle envelope
GO:0005635	0.665	nuclear envelope
GO:0031965	0.621	nuclear membrane
GO:0032991	0.451	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]