StarFunc result for job id Q9P2A4

User Input

>input (366 residues)
MAELQQLQEFEIPTGREALRGNHSALLRVADYCEDNYVQATDKRKALEETMAFTTQALAS
VAYQVGNLAGHTLRMLDLQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPP
GQKVIAPENLPPLTPYCRRPLNFGCLDDIGHGIKDLSTQLSRTGTLSRKSIKAPATPASA
TLGRPPRIPEPVHLPVVPDGRLSAASSAFSLASAGSAEGVGGAPTPKGQAAPPAPPLPSS
LDPPPPPAAVEVFQRPPTLEELSPPPPDEELPLPLDLPPPPPLDGDELGLPPPPPGFGPD
EPSWVPASYLEKVVTLYPYTSQKDNELSFSEGTVICVTRRYSDGWCEGVSSEGTGFFPGN
YVEPSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2A4	1.000	1.000	1.951E-57	366	1.000	1.000	Q9P2A4.pdb.gz	ABI3_HUMAN ABI gene family member 3 OS=Homo sapiens OX=9606 GN=ABI3 PE=1 SV=2
2	AFDB:Q8BYZ1	0.595	0.594	6.631E-48	367	0.858	0.856	Q8BYZ1.pdb.gz	ABI3_MOUSE ABI gene family member 3 OS=Mus musculus OX=10090 GN=Abi3 PE=1 SV=3
3	AFDB:P62484	0.406	0.343	2.463E-28	446	0.473	0.388	P62484.pdb.gz	ABI2_MOUSE Abl interactor 2 OS=Mus musculus OX=10090 GN=Abi2 PE=1 SV=1
4	AFDB:Q8IZP0	0.445	0.333	1.761E-27	508	0.511	0.368	Q8IZP0.pdb.gz	ABI1_HUMAN Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1 PE=1 SV=4
5	AFDB:Q8CBW3	0.426	0.334	5.009E-27	481	0.503	0.383	Q8CBW3.pdb.gz	ABI1_MOUSE Abl interactor 1 OS=Mus musculus OX=10090 GN=Abi1 PE=1 SV=3
6	AFDB:Q66IV2	0.386	0.288	5.664E-27	503	0.508	0.370	Q66IV2.pdb.gz	Q66IV2_XENLA Abl interactor 1 S homeolog OS=Xenopus laevis OX=8355 GN=abi1.S PE=2 SV=1
7	AFDB:E9PEZ7	0.397	0.324	1.713E-26	458	0.467	0.373	E9PEZ7.pdb.gz	E9PEZ7_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
8	AFDB:Q9NYB9	0.425	0.313	2.060E-26	513	0.492	0.351	Q9NYB9.pdb.gz	ABI2_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
9	AFDB:E7EW77	0.359	0.279	3.368E-26	480	0.481	0.367	E7EW77.pdb.gz	E7EW77_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
10	AFDB:F8WAL6	0.361	0.251	2.723E-25	542	0.505	0.341	F8WAL6.pdb.gz	F8WAL6_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=3
11	PDB:4n78F	0.345	0.773	3.994E-14	156	0.227	0.532	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
12	PDB:3ehqA	0.153	0.299	4.222E-5	182	0.046	0.093	3ehqA.pdb.gz
13	PDB:3qwyA	0.159	0.333	6.904E-5	170	0.044	0.094	3qwyA.pdb.gz
14	PDB:1griA	0.147	0.252	7.807E-5	211	0.055	0.095	1griA.pdb.gz
15	PDB:2dybA	0.142	0.174	7.807E-5	298	0.046	0.057	2dybA.pdb.gz
16	PDB:2h8hA	0.142	0.117	2.361E-4	445	0.052	0.043	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
17	PDB:6x5hA	0.146	0.114	4.105E-4	467	0.036	0.028	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
18	PDB:1k0xA	0.150	0.477	4.937E-4	108	0.033	0.111	1k0xA.pdb.gz
19	PDB:1k9aB	0.146	0.122	4.937E-4	441	0.041	0.034	1k9aB.pdb.gz
20	PDB:4mt6A	0.136	0.128	9.129E-4	389	0.036	0.033	4mt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P2A4	0.0	733	366	1.000	1.000	ABI3_HUMAN ABI gene family member 3 OS=Homo sapiens OX=9606 GN=ABI3 PE=1 SV=2
2	Q8BYZ1	3.98e-174	490	367	0.814	0.812	ABI3_MOUSE ABI gene family member 3 OS=Mus musculus OX=10090 GN=Abi3 PE=1 SV=3
3	Q9QZM5	4.96e-60	202	476	0.284	0.218	ABI1_RAT Abl interactor 1 OS=Rattus norvegicus OX=10116 GN=Abi1 PE=1 SV=3
4	Q8CBW3	1.70e-58	198	481	0.287	0.218	ABI1_MOUSE Abl interactor 1 OS=Mus musculus OX=10090 GN=Abi1 PE=1 SV=3
5	Q8IZP0	4.54e-58	198	508	0.284	0.205	ABI1_HUMAN Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1 PE=1 SV=4
6	Q66IV2	8.52e-57	194	503	0.281	0.205	Q66IV2_XENLA Abl interactor 1 S homeolog OS=Xenopus laevis OX=8355 GN=abi1.S PE=2 SV=1
7	P62484	1.19e-54	187	446	0.279	0.229	ABI2_MOUSE Abl interactor 2 OS=Mus musculus OX=10090 GN=Abi2 PE=1 SV=1
8	A0A0C4DG21	1.40e-54	189	507	0.279	0.201	A0A0C4DG21_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
9	E7EP65	3.55e-54	187	486	0.281	0.212	E7EP65_HUMAN Abl interactor 2 (Fragment) OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
10	E7EW77	3.87e-54	187	480	0.281	0.215	E7EW77_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
11	Q9NYB9	6.26e-54	187	513	0.281	0.201	ABI2_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
12	F8WAL6	1.19e-53	187	542	0.284	0.192	F8WAL6_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=3
13	E9PEZ7	1.22e-52	182	458	0.240	0.192	E9PEZ7_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
14	A0A0B4K774	2.39e-34	134	477	0.213	0.164	A0A0B4K774_DROME Abelson interacting protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
15	A0A0B4KH51	2.45e-34	134	472	0.213	0.165	A0A0B4KH51_DROME Abelson interacting protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
16	Q9Y0S9	2.49e-34	134	473	0.213	0.165	Q9Y0S9_DROME Abelson interacting protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
17	Q10929	6.02e-34	132	469	0.183	0.143	Q10929_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abi-1 PE=1 SV=2
18	Q586U8	1.89e-08	58.5	762	0.071	0.034	Q586U8_TRYB2 Paraflagellar rod protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.515 PE=4 SV=1
19	Q90748	2.40e-07	55.1	1099	0.145	0.048	Q90748_CHICK Brush border myosin IB OS=Gallus gallus OX=9031 GN=CBBMIB PE=2 SV=1
20	Q09746	2.59e-07	54.7	642	0.107	0.061	BZZ1_SCHPO Protein BZZ1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bzz1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07815 Abi_HHR	1.1e-24	97.7	Abl-interactor HHR
2	PF00018 SH3_1	1.2e-06	39.3	SH3 domain
3	PF07653 SH3_2	4.8e-06	37.6	Variant SH3 domain
4	PF14604 SH3_9	2.5e-09	48.2	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225941

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284322	0.973	Target of Nesh-SH3
2	9606.ENSP00000316338	0.811	Brain-specific angiogenesis inhibitor 1-associated protein 2
3	9606.ENSP00000432472	0.805	Protein BRICK1
4	9606.ENSP00000483313	0.796	Wiskott-Aldrich syndrome protein family member 2
5	9606.ENSP00000444645	0.782	Cytoplasmic FMR1-interacting protein 2
6	9606.ENSP00000481038	0.758	Cytoplasmic FMR1-interacting protein 1
7	9606.ENSP00000354251	0.726	Nck-associated protein 1
8	9606.ENSP00000376368	0.722	Wiskott-Aldrich syndrome protein family member 1
9	9606.ENSP00000335055	0.705	Wiskott-Aldrich syndrome protein family member 3
10	9606.ENSP00000293373	0.687	Nck-associated protein 1-like
11	9606.ENSP00000429931	0.672	Eukaryotic translation initiation factor 3 subunit H
12	9606.ENSP00000340688	0.654	Adhesion G protein-coupled receptor L1
13	9606.ENSP00000322270	0.651	Adhesion G protein-coupled receptor L2
14	9606.ENSP00000281172	0.640	Epidermal growth factor receptor kinase substrate 8
15	9606.ENSP00000362205	0.622	Triggering receptor expressed on myeloid cells 2
16	9606.ENSP00000365891	0.609	Wiskott-Aldrich syndrome protein
17	9606.ENSP00000482457	0.591	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
18	9606.ENSP00000426022	0.586	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
19	9606.ENSP00000361423	0.571	Tyrosine-protein kinase ABL1
20	9606.ENSP00000262629	0.562	TYRO protein tyrosine kinase-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.912	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0050794	0.992	regulation of cellular process
GO:0048518	0.969	positive regulation of biological process
GO:0048522	0.963	positive regulation of cellular process
GO:0009987	0.877	cellular process
GO:0019222	0.852	regulation of metabolic process
GO:0031323	0.844	regulation of cellular metabolic process
GO:0006950	0.785	response to stress
GO:0009893	0.616	positive regulation of metabolic process
GO:0031325	0.509	positive regulation of cellular metabolic process
GO:0051128	0.416	regulation of cellular component organization
GO:0051716	0.412	cellular response to stimulus
GO:0060255	0.384	regulation of macromolecule metabolic process
GO:0016043	0.376	cellular component organization
GO:0048519	0.352	negative regulation of biological process
GO:0048523	0.324	negative regulation of cellular process
GO:0006952	0.320	defense response
GO:0080090	0.320	regulation of primary metabolic process
GO:0007154	0.311	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.999	protein-containing complex
GO:0120025	0.990	plasma membrane bounded cell projection
GO:0031252	0.980	cell leading edge
GO:0031209	0.980	SCAR complex
GO:0030027	0.959	lamellipodium
GO:0016020	0.956	membrane
GO:0043226	0.905	organelle
GO:0043229	0.801	intracellular organelle
GO:0043227	0.786	membrane-bounded organelle
GO:0005829	0.363	cytosol
GO:0043231	0.357	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]