StarFunc result for job id Q9P2B4

User Input

>input (639 residues)
MNLEKLSKPELLTLFSILEGELEARDLVIEALKAQHRDTFIEERYGKYNISDPLMALQRD
FETLKEKNDGEKQPVCTNPLSILKVVMKQCKNMQERMLSQLAAAESRHRKVILDLEEERQ
RHAQDTAEGDDVTYMLEKERERLTQQLEFEKSQVKKFEKEQKKLSSQLEEERSRHKQLSS
MLVLECKKATNKAAEEGQKAGELSLKLEKEKSRVSKLEEELAAERKRGLQTEAQVEKQLS
EFDIEREQLRAKLNREENRTKTLKEEMESLKKIVKDLEASHQHSSPNEQLKKPVTVSKGT
ATEPLMLMSVFCQTESFPAERTHGSNIAKMTNTGLPGPATPAYSYAKTNGHCDPEIQTTR
ELTAGNNVENQVPPREKSVALAQEKPVENGGCPVGIETPVPMPSPLSSSGSSLSPSSTAS
SSLTSSPCSSPVLTKRLLGSSASSPGYQSSYQVGINQRFHAARHKFQSQADQDQQASGLQ
SPPSRDLSPTLIDNSAAKQLARNTVTQVLSRFTSQQGPIKPVSPNSSPFGTDYRNLANTA
NPRGDTSHSPTPGKVSSPLSPLSPGIKSPTIPRAERGNPPPIPPKKPGLTPSPSATTPLT
KTHSQAASLTTAEDLASSCSSNTVVANGKDVELLLPTSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2B4	0.999	0.999	3.299E-87	639	1.000	1.000	Q9P2B4.pdb.gz	CT2NL_HUMAN CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2
2	AFDB:Q99LJ0	0.502	0.503	5.663E-79	638	0.897	0.898	Q99LJ0.pdb.gz	CT2NL_MOUSE CTTNBP2 N-terminal-like protein OS=Mus musculus OX=10090 GN=Cttnbp2nl PE=1 SV=1
3	AFDB:Q8WZ74	0.184	0.075	8.770E-25	1663	0.399	0.153	Q8WZ74.pdb.gz	CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens OX=9606 GN=CTTNBP2 PE=1 SV=1
4	AFDB:Q95QQ9	0.199	0.228	1.457E-10	552	0.207	0.239	Q95QQ9.pdb.gz	Q95QQ9_CAEEL Cortactin-binding protein-2 N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C49H3.6 PE=1 SV=2
5	AFDB:Q6P9F0	0.152	0.145	2.836E-5	684	0.161	0.151	Q6P9F0.pdb.gz	CCD62_HUMAN Coiled-coil domain-containing protein 62 OS=Homo sapiens OX=9606 GN=CCDC62 PE=1 SV=2
6	AFDB:F4IPB2	0.139	0.140	3.281E-5	630	0.158	0.160	F4IPB2.pdb.gz	F4IPB2_ARATH Microtubule-associated proteins 70-3 OS=Arabidopsis thaliana OX=3702 GN=MAP70-3 PE=1 SV=1
7	AFDB:Q385Y2	0.217	0.238	3.281E-5	566	0.142	0.161	Q385Y2.pdb.gz	Q385Y2_TRYB2 Basal body-orientation factor 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1900 PE=4 SV=1
8	AFDB:Q93XY1	0.194	0.185	4.724E-5	682	0.108	0.101	Q93XY1.pdb.gz	Q93XY1_ARATH At5g53620 OS=Arabidopsis thaliana OX=3702 GN=MNC6.16 PE=1 SV=1
9	AFDB:Q6UVJ0	0.195	0.191	8.467E-5	657	0.138	0.134	Q6UVJ0.pdb.gz	SAS6_HUMAN Spindle assembly abnormal protein 6 homolog OS=Homo sapiens OX=9606 GN=SASS6 PE=1 SV=1
10	AFDB:Q86W92	0.149	0.102	1.219E-4	1011	0.171	0.108	Q86W92.pdb.gz	LIPB1_HUMAN Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2
11	PDB:7ung3	0.147	0.279	2.001	297	0.077	0.165	7ung3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
12	PDB:7mf3B	0.141	0.105	3.333	896	0.066	0.047	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
13	PDB:3jd5d	0.076	0.253	5.553	176	0.038	0.136	3jd5d.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
14	PDB:5c5eA	0.046	0.091	6.425	284	0.023	0.053	5c5eA.pdb.gz	Protein-Protein Interactions in the Cyanobacterial Circadian Clock: Structure of KaiA Dimer in Complex with C-Terminal KaiC Peptides at 2.8 angstrom Resolution.
15	PDB:7qp7y	0.038	0.038	6.911	642	0.014	0.014	7qp7y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
16	PDB:4v60A	0.100	0.082	7.996	812	0.077	0.060	4v60A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99LJ0	0.0	1060	638	0.897	0.898	CT2NL_MOUSE CTTNBP2 N-terminal-like protein OS=Mus musculus OX=10090 GN=Cttnbp2nl PE=1 SV=1
2	Q9P2B4	0.0	1296	639	1.000	1.000	CT2NL_HUMAN CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2
3	Q8WZ74	1.27e-102	344	1663	0.399	0.153	CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens OX=9606 GN=CTTNBP2 PE=1 SV=1
4	Q2IBD4	1.50e-93	318	1649	0.380	0.147	CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cttnbp2 PE=1 SV=1
5	B9EJA2	1.44e-69	248	1648	0.208	0.081	CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus OX=10090 GN=Cttnbp2 PE=1 SV=2
6	Q8SX68	1.24e-35	144	609	0.150	0.158	CT2NL_DROME CTTNBP2 N-terminal-like protein OS=Drosophila melanogaster OX=7227 GN=Naus PE=1 SV=1
7	Q7Z7B0	2.85e-29	126	1213	0.146	0.077	FLIP1_HUMAN Filamin-A-interacting protein 1 OS=Homo sapiens OX=9606 GN=FILIP1 PE=1 SV=1
8	Q9CS72	2.87e-29	126	1214	0.146	0.077	FLIP1_MOUSE Filamin-A-interacting protein 1 OS=Mus musculus OX=10090 GN=Filip1 PE=1 SV=3
9	Q8K4T4	1.19e-28	124	1212	0.144	0.076	FLIP1_RAT Filamin-A-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Filip1 PE=1 SV=1
10	Q4L180	3.89e-25	113	1135	0.135	0.076	FIL1L_HUMAN Filamin A-interacting protein 1-like OS=Homo sapiens OX=9606 GN=FILIP1L PE=1 SV=2
11	Q95QQ9	3.11e-21	100	552	0.106	0.123	Q95QQ9_CAEEL Cortactin-binding protein-2 N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C49H3.6 PE=1 SV=2
12	A0A075B6G6	4.22e-21	100	1114	0.119	0.068	A0A075B6G6_HUMAN Filamin A interacting protein 1 OS=Homo sapiens OX=9606 GN=FILIP1 PE=1 SV=1
13	H2KZD4	9.31e-21	98.2	498	0.106	0.137	H2KZD4_CAEEL Cortactin-binding protein-2 N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C49H3.6 PE=1 SV=1
14	Q8IDX6	0.001	45.1	3130	0.083	0.017	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
15	Q60698	0.010	41.6	725	0.091	0.080	SKI_MOUSE Ski oncogene OS=Mus musculus OX=10090 GN=Ski PE=1 SV=2
16	P42566	0.011	41.6	896	0.069	0.049	EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2
17	A0A0G2K628	0.014	40.8	727	0.086	0.076	A0A0G2K628_RAT Ski oncogene OS=Rattus norvegicus OX=10116 GN=Ski PE=1 SV=2
18	P12755	0.015	40.8	728	0.078	0.069	SKI_HUMAN Ski oncogene OS=Homo sapiens OX=9606 GN=SKI PE=1 SV=1
19	A0A8I5ZYW7	0.019	40.4	686	0.086	0.080	A0A8I5ZYW7_RAT Ski oncogene OS=Rattus norvegicus OX=10116 GN=Ski PE=3 SV=1
20	Q5AS68	0.024	40.4	1569	0.080	0.033	Q5AS68_EMENI Aspergillus nidulans myosin V homolog (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08862 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09727 CortBP2	9.5e-67	236.2	Cortactin-binding protein-2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000271277

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263918	0.998	Striatin
2	9606.ENSP00000358810	0.998	Striatin-interacting protein 1
3	9606.ENSP00000375777	0.998	Striatin-4
4	9606.ENSP00000315702	0.997	MOB-like protein phocein
5	9606.ENSP00000350071	0.996	Striatin-3
6	9606.ENSP00000325748	0.995	Serine/threonine-protein kinase 25
7	9606.ENSP00000365730	0.995	Serine/threonine-protein kinase 24
8	9606.ENSP00000376506	0.995	Programmed cell death protein 10
9	9606.ENSP00000377867	0.995	Serine/threonine-protein kinase 26
10	9606.ENSP00000324804	0.994	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
11	9606.ENSP00000221138	0.993	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
12	9606.ENSP00000418447	0.993	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
13	9606.ENSP00000160373	0.992	Cortactin-binding protein 2
14	9606.ENSP00000249344	0.971	Striatin-interacting protein 2
15	9606.ENSP00000311344	0.914	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
16	9606.ENSP00000295951	0.731	Sarcolemmal membrane-associated protein
17	9606.ENSP00000229395	0.704	FGFR1 oncogene partner 2
18	9606.ENSP00000358541	0.657	Suppressor of IKBKE 1
19	9606.ENSP00000303758	0.595	Leucine zipper protein 1
20	9606.ENSP00000343658	0.520	Mitogen-activated protein kinase kinase kinase kinase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019902	0.997	phosphatase binding
GO:0051721	0.985	protein phosphatase 2A binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0006793	0.986	phosphorus metabolic process
GO:0006796	0.981	phosphate-containing compound metabolic process
GO:0036211	0.978	protein modification process
GO:0050794	0.975	regulation of cellular process
GO:0016311	0.866	dephosphorylation
GO:0048523	0.850	negative regulation of cellular process
GO:0006470	0.837	protein dephosphorylation
GO:0065009	0.609	regulation of molecular function
GO:0050896	0.415	response to stimulus
GO:0071840	0.362	cellular component organization or biogenesis
GO:0048518	0.306	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.998	cytoskeleton
GO:0015629	0.991	actin cytoskeleton
GO:0043227	0.933	membrane-bounded organelle
GO:0043231	0.921	intracellular membrane-bounded organelle
GO:0005737	0.796	cytoplasm
GO:0005829	0.751	cytosol
GO:0012505	0.459	endomembrane system
GO:0005634	0.399	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]