StarFunc result for job id Q9P2D0

User Input

>input (1353 residues)
MSSPMPDCTSKCRSLKHALDVLSVVTKGSENQIKAFLSSHCYNAATIKDVFGRNALHLVS
SCGKKGVLDWLIQKGVDLLVKDKESGWTALHRSIFYGHIDCVWSLLKHGVSLYIQDKEGL
SALDLVMKDRPTHVVFKNTDPTDVYTWGDNTNFTLGHGSQNSKHHPELVDLFSRSGIYIK
QVVLCKFHSVFLSQKGQVYTCGHGPGGRLGHGDEQTCLVPRLVEGLNGHNCSQVAAAKDH
TVVLTEDGCVYTFGLNIFHQLGIIPPPSSCNVPRQIQAKYLKGRTIIGVAAGRFHTVLWT
REAVYTMGLNGGQLGCLLDPNGEKCVTAPRQVSALHHKDIALSLVAASDGATVCVTTRGD
IYLLADYQCKKMASKQLNLKKVLVSGGHMEYKVDPEHLKENGGQKICILAMDGAGRVFCW
RSVNSSLKQCRWAYPRQVFISDIALNRNEILFVTQDGEGFRGRWFEEKRKSSEKKEILSN
LHNSSSDVSYVSDINSVYERIRLEKLTFAHRAVSVSTDPSGCNFAILQSDPKTSLYEIPA
VSSSSFFEEFGKLLREADEMDSIHDVTFQVGNRLFPAHKYILAVHSDFFQKLFLSDGNTS
EFTDIYQKDEDSAGCHLFVVEKVHPDMFEYLLQFIYTDTCDFLTHGFKPRIHLNKNPEEY
QGTLNSHLNKVNFHEDDNQKSAFEVYKSNQAQTVSERQKSKPKSCKKGKNIREDDPVRML
QTVAKKFDFSNLSSRLDGVRFENEKINVIAKNTGNKLKLSQKKCSFLCDVTMKSVDGKEF
PCHKCVLCARLEYFHSMLSSSWIEASSCAALEMPIHSDILKVILDYLYTDEAVVIKESQN
VDFICSVLVVADQLLITRLKEICEVALTEKLTLKNAAMLLEFAAMYSAKQLKLSCLQFIG
LNMAALLEARSLDVLSDGVLKDLSEFYRKMIPAMDRRVITPYQDGPDISYLEVEDGDIFL
KEEINMEQNHSETMFKKAKTKAKKKPRKRSDSSGGYNLSDIIQSPSSTGLLKSGKTNSVE
SLPELLTSDSEGSYAGVGSPRDLQSPDFTTGFHSDKIEAKVKPYVNGTSPVYSREDLKPW
EKSPILKISAPQPIPSNRIDTTSSASWVAGSFSPVSPPVVDLRTIMEIEESRQKCGATPK
SHLGKTVSHGVKLSQKQRKMIALTTKENNSGMNSMETVLFTPSKAPKPVNAWASSLHSVS
SKSFRDFLLEEKKSVTSHSSGDHVKKVSFKGIENSQAPKIVRCSTHGTPGPEGNHISDLP
LLDSPNPWLSSSVTAPSMVAPVTFASIVEEELQQEAALIRSREKPLALIQIEEHAIQDLL
VFYEAFGNPEEFVIVERTPQGPLAVPMWNKHGC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PDR5	0.394	0.460	0.000	1152	0.850	0.998	E9PDR5.pdb.gz	E9PDR5_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens OX=9606 GN=IBTK PE=1 SV=1
2	AFDB:Q9P2D0	1.000	1.000	0.000	1353	1.000	1.000	Q9P2D0.pdb.gz	IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens OX=9606 GN=IBTK PE=1 SV=3
3	AFDB:O74881	0.443	0.445	1.279E-52	1347	0.213	0.214	O74881.pdb.gz	BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=btb1 PE=1 SV=1
4	PDB:8gqeB	0.202	0.666	8.277E-21	386	0.061	0.215	8gqeB.pdb.gz
5	PDB:5tbkI	0.214	0.644	1.661E-17	419	0.064	0.208	5tbkI.pdb.gz
6	AFDB:F1QM29	0.204	0.196	5.338E-17	1413	0.101	0.097	F1QM29.pdb.gz	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
7	PDB:5t94A	0.215	0.600	2.434E-15	454	0.047	0.139	5t94A.pdb.gz
8	PDB:5xgsA	0.207	0.650	7.580E-15	398	0.047	0.161	5xgsA.pdb.gz
9	AFDB:Q54PV1	0.164	0.128	1.126E-13	1800	0.112	0.084	Q54PV1.pdb.gz	Q54PV1_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P2 PE=4 SV=1
10	PDB:4d4oA	0.193	0.584	2.403E-13	414	0.058	0.188	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
11	PDB:6qk7B	0.140	0.238	4.182E-7	749	0.030	0.055	6qk7B.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
12	PDB:7d4iBE	0.120	0.169	6.522E-7	890	0.055	0.084	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
13	PDB:6nd4Q	0.123	0.181	7.199E-7	862	0.027	0.043	6nd4Q.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
14	PDB:6lqsBE	0.140	0.215	7.946E-7	823	0.024	0.040	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
15	PDB:7mq8SG	0.146	0.443	7.946E-7	389	0.030	0.103	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	AFDB:Q17602	0.129	0.126	1.240E-5	1390	0.116	0.113	Q17602.pdb.gz	NU214_CAEEL Nuclear pore complex protein 14 OS=Caenorhabditis elegans OX=6239 GN=npp-14 PE=1 SV=1
17	AFDB:Q9NRJ4	0.146	0.131	1.438E-5	1543	0.098	0.086	Q9NRJ4.pdb.gz	TULP4_HUMAN Tubby-related protein 4 OS=Homo sapiens OX=9606 GN=TULP4 PE=1 SV=2
18	AFDB:F1LRR4	0.082	0.074	1.464E-4	1551	0.119	0.104	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
19	AFDB:Q9W1X4	0.126	0.103	3.562E-4	1711	0.126	0.100	Q9W1X4.pdb.gz	NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster OX=7227 GN=Nup214 PE=1 SV=2
20	AFDB:F1QPU2	0.075	0.061	5.125E-3	1719	0.079	0.062	F1QPU2.pdb.gz	F1QPU2_DANRE Structure-specific endonuclease subunit SLX4 OS=Danio rerio OX=7955 GN=slx4 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EPI0	0.0	2776	1338	0.989	1.000	E7EPI0_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens OX=9606 GN=IBTK PE=1 SV=1
2	E9PDR5	0.0	1147	1152	0.411	0.483	E9PDR5_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens OX=9606 GN=IBTK PE=1 SV=1
3	Q9P2D0	0.0	2814	1353	1.000	1.000	IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens OX=9606 GN=IBTK PE=1 SV=3
4	O74881	1.13e-37	157	1347	0.086	0.087	BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=btb1 PE=1 SV=1
5	O95714	1.14e-17	92.4	4834	0.050	0.014	HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
6	Q4U2R1	1.17e-17	92.4	4836	0.050	0.014	HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
7	E8NHA2	1.42e-15	84.7	1062	0.055	0.070	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
8	Q9FN03	1.48e-15	83.2	440	0.043	0.132	UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
9	Q15751	2.83e-15	84.3	4861	0.050	0.014	HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2
10	Q6PAV2	3.51e-15	83.6	1057	0.045	0.058	HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus OX=10090 GN=Herc4 PE=1 SV=2
11	Q5GLZ8	3.88e-15	83.6	1057	0.045	0.058	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
12	E9PZP8	6.20e-15	83.2	4859	0.049	0.014	E9PZP8_MOUSE HECT and RLD domain containing E3 ubiquitin protein ligase family member 1 OS=Mus musculus OX=10090 GN=Herc1 PE=1 SV=1
13	Q9UII4	6.25e-15	82.8	1024	0.041	0.055	HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens OX=9606 GN=HERC5 PE=1 SV=2
14	Q8BNF7	6.35e-15	82.8	1203	0.049	0.055	Q8BNF7_MOUSE E3 ubiquitin-protein ligase HERC1 (Fragment) OS=Mus musculus OX=10090 GN=Herc1 PE=2 SV=2
15	Q80YD6	9.86e-15	80.9	464	0.055	0.159	SRGEF_MOUSE Secretion-regulating guanine nucleotide exchange factor OS=Mus musculus OX=10090 GN=Sergef PE=2 SV=2
16	F2Z461	1.35e-14	81.6	1003	0.050	0.068	HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
17	Q9M8J9	2.05e-14	79.3	406	0.041	0.138	BPM2_ARATH BTB/POZ and MATH domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=BPM2 PE=1 SV=1
18	Q6NYE2	8.82e-14	78.2	495	0.061	0.166	RCC2_DANRE Protein RCC2 homolog OS=Danio rerio OX=7955 GN=rcc2 PE=2 SV=1
19	Q9P258	1.00e-13	77.8	522	0.061	0.157	RCC2_HUMAN Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2
20	Q99LJ7	1.79e-13	77.4	551	0.047	0.114	RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rcbtb2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.0052	28.3	Ankyrin repeat
2	PF12796 Ank_2	2.5e-06	39.3	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.017	26.4	Ankyrin repeat
4	PF13637 Ank_4	2.9e-05	35.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	9.9e-07	40.2	Ankyrin repeats (many copies)
6	PF00651 BTB	9e-30	114.5	BTB/POZ domain
7	PF00415 RCC1	6.2e-32	121.3	Regulator of chromosome condensation (RCC1) repeat
8	PF13540 RCC1_2	1.6e-06	39.0	Regulator of chromosome condensation (RCC1) repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305721

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483570	0.989	Tyrosine-protein kinase BTK
2	9606.ENSP00000264414	0.927	Cullin-3
3	9606.ENSP00000482457	0.922	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
4	9606.ENSP00000376544	0.918	B-cell antigen receptor complex-associated protein beta chain
5	9606.ENSP00000364907	0.912	Tyrosine-protein kinase SYK
6	9606.ENSP00000428924	0.907	Tyrosine-protein kinase Lyn
7	9606.ENSP00000221972	0.905	B-cell antigen receptor complex-associated protein alpha chain
8	9606.ENSP00000224337	0.904	B-cell linker protein
9	9606.ENSP00000303507	0.904	Breakpoint cluster region protein
10	9606.ENSP00000384371	0.904	B-cell lymphoma 6 protein
11	9606.ENSP00000320563	0.712	WD repeat- and FYVE domain-containing protein 4
12	9606.ENSP00000358956	0.703	Interleukin-1 receptor-associated kinase 1-binding protein 1
13	9606.ENSP00000286918	0.680	Ankyrin repeat domain-containing protein 9
14	9606.ENSP00000293831	0.678	Eukaryotic initiation factor 4A-I
15	9606.ENSP00000329926	0.674	Calcium homeostasis modulator protein 1
16	9606.ENSP00000236979	0.655	Spermatid nuclear transition protein 1
17	9606.ENSP00000261523	0.649	Nuclear receptor ROR-alpha
18	9606.ENSP00000220496	0.640	DnaJ homolog subfamily C member 17
19	9606.ENSP00000373301	0.627	SH3 domain-binding protein 5
20	9606.ENSP00000398655	0.610	Tyrosine-protein kinase ITK/TSK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.998	protein kinase binding
GO:0004860	0.998	protein kinase inhibitor activity
GO:0030292	0.557	protein tyrosine kinase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0019222	0.956	regulation of metabolic process
GO:0031399	0.939	regulation of protein modification process
GO:0048523	0.913	negative regulation of cellular process
GO:0051172	0.912	negative regulation of nitrogen compound metabolic process
GO:0070588	0.910	calcium ion transmembrane transport
GO:0051174	0.901	regulation of phosphorus metabolic process
GO:0097553	0.894	calcium ion transmembrane import into cytosol
GO:0051282	0.890	regulation of sequestering of calcium ion
GO:0019220	0.796	regulation of phosphate metabolic process
GO:0051283	0.777	negative regulation of sequestering of calcium ion
GO:0010563	0.768	negative regulation of phosphorus metabolic process
GO:0031400	0.750	negative regulation of protein modification process
GO:0045936	0.735	negative regulation of phosphate metabolic process
GO:0051209	0.728	release of sequestered calcium ion into cytosol
GO:0042325	0.714	regulation of phosphorylation
GO:0042326	0.667	negative regulation of phosphorylation
GO:0001932	0.589	regulation of protein phosphorylation
GO:0050896	0.550	response to stimulus
GO:0001933	0.522	negative regulation of protein phosphorylation
GO:0071704	0.495	organic substance metabolic process
GO:0044238	0.489	primary metabolic process
GO:0006807	0.451	nitrogen compound metabolic process
GO:0043170	0.398	macromolecule metabolic process
GO:0051716	0.390	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.978	cytoplasm
GO:0005829	0.529	cytosol
GO:0016020	0.403	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]