StarFunc result for job id Q9P2D1

User Input

>input (1400 residues)
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTN
QNQTKLTHFDHYNQYEQQKMHLMDQPNRMMSNTPGNGLASPHSQYHTPPVPQVPHGGSGG
GQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQ
GHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQ
QSPSMAPSLRHSVQQFHHHPSTALHGESVAHSPRFSPNPPQQGAVRPQTLNFSSRSQTVP
SPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNSGQG
LMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGI
PMEVGSYPNMPHPQPSHQPPGAMGIGQRNMGPRNMQQSRPFIGMSSAPRELTGHMRPNGC
PGVGLGDPQAIQERLIPGQQHPGQQPSFQQLPTCPPLQPHPGLHHQSSPPHPHHQPWAQL
HPSPQNTPQKVPVHQHSPSEPFLEKPVPDMTQVSGPNAQLVKSDDYLPSIEQQPQQKKKK
KKNNHIVAEDPSKGFGKDDFPGGVDNQELNRNSLDGSQEEKKKKKRSKAKKDPKEPKEPK
EKKEPKEPKTPKAPKIPKEPKEKKAKTATPKPKSSKKSSNKKPDSEASALKKKVNKGKTE
GSENSDLDKTPPPSPPPEEDEDPGVQKRRSSRQVKRKRYTEDLEFKISDEEADDADAAGR
DSPSNTSQSEQQESVDAEGPVVEKIMSSRSVKKQKESGEEVEIEEFYVKYKNFSYLHCQW
ASIEDLEKDKRIQQKIKRFKAKQGQNKFLSEIEDELFNPDYVEVDRIMDFARSTDDRGEP
VTHYLVKWCSLPYEDSTWERRQDIDQAKIEEFEKLMSREPETERVERPPADDWKKSESSR
EYKNNNKLREYQLEGVNWLLFNWYNMRNCILADEMGLGKTIQSITFLYEIYLKGIHGPFL
VIAPLSTIPNWEREFRTWTELNVVVYHGSQASRRTIQLYEMYFKDPQGRVIKGSYKFHAI
ITTFEMILTDCPELRNIPWRCVVIDEAHRLKNRNCKLLEGLKMMDLEHKVLLTGTPLQNT
VEELFSLLHFLEPSRFPSETTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAP
KEETIIEVELTNIQKKYYRAILEKNFTFLSKGGGQANVPNLLNTMMELRKCCNHPYLING
AEEKILEEFKETHNAESPDFQLQAMIQAAGKLVLIDKLLPKLKAGGHRVLIFSQMVRCLD
ILEDYLIQRRYPYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADT
CIIFDSDWNPQNDLQAQARC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q09XV5	0.423	0.233	4.024E-96	2582	0.451	0.244	Q09XV5.pdb.gz	CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus OX=10090 GN=Chd8 PE=1 SV=1
2	AFDB:B0R0I6	0.424	0.239	9.597E-95	2511	0.414	0.231	B0R0I6.pdb.gz	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
3	PDB:6g0lM	0.357	0.572	4.554E-44	855	0.169	0.276	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
4	PDB:6g0lW	0.366	0.570	7.357E-43	878	0.175	0.279	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
5	PDB:6jylK	0.271	0.725	4.119E-34	504	0.146	0.405	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
6	PDB:7epuB	0.210	0.351	2.828E-32	748	0.143	0.267	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
7	PDB:6tdaS	0.273	0.475	2.096E-31	783	0.135	0.241	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
8	PDB:7oo3b	0.252	0.616	8.248E-30	534	0.100	0.262	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
9	PDB:6uxwA	0.270	0.473	4.894E-29	778	0.127	0.229	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
10	PDB:6kw3Y	0.270	0.647	9.671E-27	548	0.131	0.336	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
11	PDB:6gejM	0.257	0.507	6.066E-26	688	0.121	0.247	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
12	PDB:5vvrM	0.237	0.600	5.314E-25	503	0.098	0.272	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
13	AFDB:A7E291	0.024	0.043	1.122E-12	654	0.202	0.433	A7E291.pdb.gz
14	AFDB:O76743	0.184	0.217	3.552E-6	1156	0.117	0.142	O76743.pdb.gz	GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans OX=6239 GN=glh-4 PE=1 SV=2
15	AFDB:Q5T5U3	0.060	0.049	5.203E-3	1958	0.121	0.087	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
16	AFDB:Q9UIF8	0.038	0.031	7.681E-3	2168	0.127	0.082	Q9UIF8.pdb.gz	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
17	AFDB:P25822	0.048	0.046	1.028	1533	0.129	0.117	P25822.pdb.gz	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
18	AFDB:Q9VYH8	0.031	0.046	1.028	894	0.081	0.126	Q9VYH8.pdb.gz	Q9VYH8_DROME Kazal-like domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15721 PE=4 SV=2
19	AFDB:Q86YC2	0.031	0.034	1.149	1186	0.097	0.115	Q86YC2.pdb.gz	PALB2_HUMAN Partner and localizer of BRCA2 OS=Homo sapiens OX=9606 GN=PALB2 PE=1 SV=1
20	AFDB:G0SAK3	0.029	0.024	1.284	1793	0.096	0.075	G0SAK3.pdb.gz	NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP145 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y4P3	0.0	809	1102	0.289	0.368	A0A2R8Y4P3_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=1
2	A0A2R8Y840	0.0	1068	1995	0.379	0.266	A0A2R8Y840_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=1
3	A2AJK6	0.0	2514	2986	0.949	0.445	CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus OX=10090 GN=Chd7 PE=1 SV=1
4	B0R0I6	0.0	1032	2511	0.357	0.199	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
5	B7Z002	0.0	869	5517	0.313	0.079	B7Z002_DROME Kismet, isoform C OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
6	F1QGL1	0.0	1206	3140	0.414	0.184	F1QGL1_DANRE DNA helicase OS=Danio rerio OX=7955 GN=chd7 PE=1 SV=1
7	H0YJG4	0.0	843	1815	0.281	0.217	H0YJG4_HUMAN Chromodomain helicase DNA binding protein 8 (Fragment) OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=2
8	H3BTW3	0.0	1075	2424	0.378	0.218	H3BTW3_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD9 PE=1 SV=9
9	M9NCY5	0.0	868	5343	0.313	0.082	M9NCY5_DROME Kismet, isoform D OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
10	M9NDB7	0.0	868	5252	0.313	0.083	M9NDB7_DROME Kismet, isoform E OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
11	M9NEL3	0.0	867	5191	0.313	0.084	M9NEL3_DROME Kismet, isoform F OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
12	Q09XV5	0.0	1075	2582	0.379	0.206	CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus OX=10090 GN=Chd8 PE=1 SV=1
13	Q3L8U1	0.0	1077	2897	0.378	0.183	CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens OX=9606 GN=CHD9 PE=1 SV=2
14	Q54UZ8	0.0	645	2373	0.234	0.138	Q54UZ8_DICDI Myb domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280705 PE=4 SV=1
15	Q8TD26	0.0	1076	2715	0.376	0.194	CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens OX=9606 GN=CHD6 PE=1 SV=4
16	Q9HCK8	0.0	1070	2581	0.379	0.205	CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=5
17	Q9JIX5	0.0	1075	2581	0.379	0.206	CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus OX=10116 GN=Chd8 PE=1 SV=2
18	Q9P2D1	0.0	2934	2997	1.000	0.467	CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens OX=9606 GN=CHD7 PE=1 SV=3
19	Q9VPL9	0.0	868	5322	0.313	0.082	Q9VPL9_DROME FI24801p1 OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=3
20	Q54CF8	2.19e-158	533	3071	0.198	0.090	Q54CF8_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293012 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00385 Chromo	5.1e-24	95.3	Chromo (CHRromatin Organisation MOdifier) domain
2	PF00270 DEAD	4.6	18.5	DEAD/DEAH box helicase
3	PF00271 Helicase_C	1e-11	56.5	Helicase conserved C-terminal domain
4	PF04851 ResIII	0.0017	29.9	Type III restriction enzyme, res subunit
5	PF00176 SNF2-rel_dom	4.3e-64	228.0	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392028

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323588	0.995	Transcription factor SOX-2
2	9606.ENSP00000271640	0.991	Histone-lysine N-methyltransferase SETDB1
3	9606.ENSP00000310275	0.941	Barrier-to-autointegration factor
4	9606.ENSP00000382595	0.917	Multifunctional protein ADE2
5	9606.ENSP00000287820	0.910	Peroxisome proliferator-activated receptor gamma
6	9606.ENSP00000384625	0.904	Serine/threonine-protein kinase NLK
7	9606.ENSP00000380093	0.894	Transcription factor SOX-10
8	9606.ENSP00000302100	0.832	Galectin-4
9	9606.ENSP00000351446	0.799	WD repeat-containing protein 5
10	9606.ENSP00000307208	0.788	Nucleosome-remodeling factor subunit BPTF
11	9606.ENSP00000395654	0.771	Transcription activator BRG1
12	9606.ENSP00000216297	0.755	FACT complex subunit SPT16
13	9606.ENSP00000335044	0.755	AT-rich interactive domain-containing protein 2
14	9606.ENSP00000217270	0.748	Prokineticin receptor 2
15	9606.ENSP00000295619	0.735	Prokineticin-2
16	9606.ENSP00000267064	0.715	SWI/SNF complex subunit SMARCC2
17	9606.ENSP00000262648	0.705	Anosmin-1
18	9606.ENSP00000386895	0.699	Protein FAM124B
19	9606.ENSP00000278412	0.685	FACT complex subunit SSRP1
20	9606.ENSP00000244537	0.683	Histone cluster 1 H4 family member f

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003682	0.998	chromatin binding
GO:1901363	0.978	heterocyclic compound binding
GO:0097159	0.975	organic cyclic compound binding
GO:0003676	0.964	nucleic acid binding
GO:0003677	0.943	DNA binding
GO:0003824	0.941	catalytic activity
GO:0042393	0.876	histone binding
GO:0140640	0.795	catalytic activity, acting on a nucleic acid
GO:0140097	0.741	catalytic activity, acting on DNA
GO:0140657	0.643	ATP-dependent activity
GO:0008094	0.500	ATP-dependent activity, acting on DNA
GO:0140658	0.379	ATP-dependent chromatin remodeler activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048731	0.986	system development
GO:0009790	0.981	embryo development
GO:0065007	0.945	biological regulation
GO:0009987	0.915	cellular process
GO:0048513	0.855	animal organ development
GO:0050789	0.850	regulation of biological process
GO:0050794	0.806	regulation of cellular process
GO:0007423	0.740	sensory organ development
GO:0021675	0.711	nerve development
GO:0090596	0.619	sensory organ morphogenesis
GO:0043583	0.614	ear development
GO:0060255	0.563	regulation of macromolecule metabolic process
GO:0043009	0.545	chordate embryonic development
GO:0048562	0.497	embryonic organ morphogenesis
GO:0021545	0.451	cranial nerve development
GO:0042471	0.445	ear morphogenesis
GO:0072359	0.375	circulatory system development
GO:0071840	0.331	cellular component organization or biogenesis
GO:0010468	0.331	regulation of gene expression
GO:0071704	0.307	organic substance metabolic process
GO:0016043	0.304	cellular component organization
GO:0044238	0.300	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043228	0.986	non-membrane-bounded organelle
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0032991	0.394	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]