StarFunc result for job id Q9P2D3

User Input

>input (2071 residues)
MELAHSLLLNEEALAQITEAKRPVFIFEWLRFLDKVLVAANKTDVKEKQKKLVEQLTGLI
SSSPGPPTRKLLAKNLAALYSIGDTFTVFQTLDKCNDIIRNKDDTAAYLPTKLAAVACVG
AFYEKMGRMLGSAFPETVNNLLKSLKSAESQGRSEILMSLQKVLSGLGGAAASSHRDIYK
NARSLLTDRSMAVRCAVAKCLLELQNEAVFMWTAELENIATLCFKALENSNYGVRVAVSK
LLGTVMATALMPKQATVMRQNVKRATFDEVLELMATGFLRGGSGFLKSGGEMLKVGGSVN
REVRVGVTQAYVVFVTTLGGQWLERSFATFLSHVLDLVSHPRATQTHVEAVYSRRCVSFI
LRATVGSLLGEKAQIAAAKEICQAIGKQMKAVEAVVNDTSGENKSGAADIAASQHVMVCA
LQELGSLVQSLNATASPLIQEASIGLLEIVTSVLLHPSMAARLAAAWCLRCVAVALPFQL
TPFLDRCAERLNNLKTSPEAVSGYSFAMAALLGGVHQCPLGIPHAKGKMVVSIAEDLLRT
AAQNSRLSLQRTQAGWLLLGALMTLGPSVVRYHLPKMLLLWRNVFPRSLKELEAEKARGD
SFTWQVTLEGRAGALCAMRSFVAHCPELLTEDVIRKLMTPIECAMTMMSHIPSVMKAHGA
HLKASAAMVRLRLYDILALLPPKTYEGSFNALLRELVAEFTLTDNSANTTTSLLRSLCHY
DDSVLLGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYLRIPAGEAVPGPLPLGVSV
IDASVALFGVVFPHVSYKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAEN
KSTLGPEEVRKSALTLVMGPLDNPNPILRCAAGEALGRMAQVVGEATFIARMAQYSFDKL
KSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLA
LIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGAIITTVGPELQGNGAT
TSTIRSSCLVGCAITQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPSLCVHLCSSHL
LLRRAAVACLRQLAQREAAEVCEYAMSLAKNTGDKESSSANVSPFAPGVSSRTDIHCRHQ
GVNITETGLEGLLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLMLCKDVLAASS
DMSTATLLSSGKDEEAEKKDEMDDDTMFTTLGEEDKSKPFVAPRWATRVFAADCLCRIIN
LCENADQAHFDLALARSAKLRNPTNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALED
IIKKFASVPEPEFPGHVILEQYQANVGAALRPAFSQDTPSDIIAKACQVCSTWIGSGVVS
DLNDLRRVHNLLVSSLDKVQAGKGSSSQLYRESATTMEKLAVLKAWAEVYVVAMNIKKEA
ESKPKRAIKNTDDDDDDCGTIDELPPDSLITLVQPELPTLSRLWLAALKDYALLTLPAEF
SSQLPPDGGAFYTPETIDTARLHYRNSWAPILHAVALWLNSTGFTCSESTEAAAISGLQK
RSTSVNLNQASGAVGSAKSLPEINKDRMHLILGVSIQFLCSPRPEEPIEHVTACLQALHT
LLDSPYARVHIAEDQLIGVELLSVLHRLLLTWNPSSVQLLVTGVVQQIVRAAQDYLQEKR
NTLNEDDMEKEACTVLGEGGDSGGLIPGKSLVFATMELLMFILVRHMPHLSTKVSDSPSH
IATKTRLSEESARLVAATVTILSDLPSLCSPAGCMTILPTILFLIARILKDTAIKSADNQ
VPPPVSAALQGIKSIVTLSMAKTEAGVQKQWTALIRSTLACILEYSQPEDSVPTPDEVSM
LTAIALFLWSASNEIIGVQSLQNGCMNRFKNALNSCDPWVQAKCYQLLLSVFQHSNRALS
TPYIHSLAPIVVEKLKAVERNRPASNIELLAVQEGIKVLETLVALGEEQNRVQLLALLVP
TLISYLLDENSFASASSASKDLHEFALQNLMHIGPLYPHAFKTVMGAAPELKVRLETAVR
ASQASKAKAAARQPAPAIHSAPTIKLKTSFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O01485	0.882	0.880	0.000	2076	0.373	0.372	O01485.pdb.gz	O01485_CAEEL HEAT repeat-containing protein 5B OS=Caenorhabditis elegans OX=6239 GN=soap-1 PE=1 SV=1
2	AFDB:Q86XA9	0.934	0.948	0.000	2040	0.577	0.585	Q86XA9.pdb.gz	HTR5A_HUMAN HEAT repeat-containing protein 5A OS=Homo sapiens OX=9606 GN=HEATR5A PE=1 SV=2
3	AFDB:Q9P2D3	1.000	1.000	0.000	2071	1.000	1.000	Q9P2D3.pdb.gz	HTR5B_HUMAN HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B PE=1 SV=2
4	AFDB:F4HRS2	0.664	0.622	8.581E-55	2222	0.211	0.197	F4HRS2.pdb.gz	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
5	AFDB:O42998	0.731	0.785	2.620E-43	1919	0.168	0.181	O42998.pdb.gz	SIP1_SCHPO Pof6 interactor protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sip1 PE=1 SV=1
6	AFDB:P39526	0.717	0.736	3.846E-36	2014	0.157	0.161	P39526.pdb.gz	LAA1_YEAST AP-1 accessory protein LAA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAA1 PE=1 SV=1
7	AFDB:F4IP13	0.143	0.166	6.603E-14	1716	0.112	0.135	F4IP13.pdb.gz	SHGR6_ARATH Protein SHOOT GRAVITROPISM 6 OS=Arabidopsis thaliana OX=3702 GN=SGR6 PE=2 SV=1
8	AFDB:B0UX67	0.179	0.149	1.108E-13	2563	0.126	0.101	B0UX67.pdb.gz
9	AFDB:Q38AC2	0.140	0.128	1.147E-13	2432	0.130	0.111	Q38AC2.pdb.gz	Q38AC2_TRYB2 Serine/threonine-protein kinase TOR OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2060 PE=3 SV=1
10	AFDB:Q10105	0.144	0.122	1.317E-13	2670	0.129	0.100	Q10105.pdb.gz	GCN1_SCHPO eIF-2-alpha kinase activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn1 PE=3 SV=1
11	PDB:6x9oA	0.213	0.190	2.018E-12	2425	0.140	0.120	6x9oA.pdb.gz
12	PDB:7mqaSP	0.116	0.103	5.126E-12	2485	0.125	0.104	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mq8SP	0.122	0.125	8.311E-12	1993	0.124	0.128	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:6bcuA	0.143	0.137	6.371E-11	2204	0.138	0.130	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
15	PDB:7tyrA	0.149	0.101	9.642E-11	3905	0.134	0.071	7tyrA.pdb.gz
16	PDB:7r04B	0.110	0.106	1.107E-10	2229	0.138	0.128	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
17	PDB:6ez8A	0.186	0.171	1.459E-10	2353	0.138	0.122	6ez8A.pdb.gz
18	PDB:7jq9A	0.126	0.113	1.618E-10	2427	0.129	0.110	7jq9A.pdb.gz
19	PDB:7mp6B	0.140	0.171	1.734E-10	1609	0.106	0.136	7mp6B.pdb.gz
20	PDB:6kwyc	0.157	0.172	1.795E-10	1811	0.117	0.134	6kwyc.pdb.gz	Cryo-EM structures of the human PA200 and PA200-20S complex reveal regulation of proteasome gate opening and two PA200 apertures.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O01485	0.0	1261	2076	0.384	0.383	O01485_CAEEL HEAT repeat-containing protein 5B OS=Caenorhabditis elegans OX=6239 GN=soap-1 PE=1 SV=1
2	Q86XA9	0.0	2419	2040	0.581	0.590	HTR5A_HUMAN HEAT repeat-containing protein 5A OS=Homo sapiens OX=9606 GN=HEATR5A PE=1 SV=2
3	Q8C547	0.0	3989	2070	0.958	0.959	HTR5B_MOUSE HEAT repeat-containing protein 5B OS=Mus musculus OX=10090 GN=Heatr5b PE=1 SV=3
4	Q9P2D3	0.0	4245	2071	1.000	1.000	HTR5B_HUMAN HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B PE=1 SV=2
5	F4HRS2	4.86e-86	317	2222	0.181	0.169	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
6	O42998	1.85e-24	115	1919	0.074	0.080	SIP1_SCHPO Pof6 interactor protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sip1 PE=1 SV=1
7	P39526	6.03e-11	70.9	2014	0.030	0.031	LAA1_YEAST AP-1 accessory protein LAA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAA1 PE=1 SV=1
8	A0A1D8PRR3	0.46	38.1	907	0.017	0.040	A0A1D8PRR3_CANAL Trehalase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NTH1 PE=3 SV=1
9	A0A8I5Y1U3	0.74	37.0	392	0.013	0.069	A0A8I5Y1U3_RAT Telomeric repeat-binding factor OS=Rattus norvegicus OX=10116 GN=Terf1 PE=4 SV=1
10	Q4GZ81	1.9	35.8	573	0.013	0.045	Q4GZ81_TRYB2 Serine/threonine protein phosphatase 2a regulatory subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1380 PE=4 SV=1
11	Q9W6A7	2.5	35.0	357	0.014	0.081	OPSR1_DANRE Red-sensitive opsin-1 OS=Danio rerio OX=7955 GN=opn1lw1 PE=1 SV=1
12	Q9RFR0	5.8	34.3	397	0.011	0.055	MGS_RHOMR Mannosylglycerate synthase OS=Rhodothermus marinus OX=29549 GN=mgs PE=1 SV=1
13	Q8L831	6.8	34.3	772	0.012	0.032	NUDT3_ARATH Nudix hydrolase 3 OS=Arabidopsis thaliana OX=3702 GN=NUDT3 PE=1 SV=1
14	Q9VUN0	8.0	33.9	1514	0.007	0.010	TOLL6_DROME Toll-like receptor 6 OS=Drosophila melanogaster OX=7227 GN=Toll-6 PE=1 SV=1
15	Q06708	8.2	33.9	880	0.016	0.037	VAC14_YEAST Vacuole morphology and inheritance protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAC14 PE=1 SV=1
16	Q93VS8	8.4	33.9	1116	0.020	0.037	Q93VS8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=KETCH1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12717 Cnd1	5.1	18.6	non-SMC mitotic condensation complex subunit 1
2	PF10410 DnaB_bind	2.1e+02	13.7	DnaB-helicase binding domain of primase
3	PF02985 HEAT	0.00094	30.2	HEAT repeat
4	PF13646 HEAT_2	6.8e-05	34.5	HEAT repeats
5	PF07730 HisKA_3	3.8e+02	13.0	Histidine kinase
6	PF20210 Laa1_Sip1_HTR5	2.2e-66	234.7	Laa1/Sip1/HEATR5 HEAT repeat region
7	PF14911 MMS22L_C	33	15.0	S-phase genomic integrity recombination mediator, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000233099

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377148	0.830	AP-1 complex subunit gamma-1
2	9606.ENSP00000250244	0.808	AP-1 complex subunit mu-2
3	9606.ENSP00000444957	0.743	AP-1 complex subunit sigma-2
4	9606.ENSP00000377250	0.648	Protein MON2 homolog
5	9606.ENSP00000261842	0.647	AP-4 complex subunit epsilon-1
6	9606.ENSP00000312442	0.647	AP-1 complex subunit gamma-like 2
7	9606.ENSP00000357402	0.626	Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2
8	9606.ENSP00000370303	0.611	Palmitoyltransferase ZDHHC21
9	9606.ENSP00000318016	0.603	WASH complex subunit 5
10	9606.ENSP00000357453	0.599	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
11	9606.ENSP00000478417	0.574	Serine/threonine-protein phosphatase 6 regulatory subunit 2
12	9606.ENSP00000263918	0.554	Striatin
13	9606.ENSP00000262879	0.540	Ral GTPase-activating protein subunit beta
14	9606.ENSP00000468678	0.530	Pleckstrin homology, MyTH4 and FERM domain containing H3
15	9606.ENSP00000484713	0.529	WASH complex subunit 4
16	9606.ENSP00000354061	0.510	SCY1-like protein 2
17	9606.ENSP00000238855	0.509	Aftiphilin
18	9606.ENSP00000482835	0.508	AP-2 complex subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0051179	0.960	localization
GO:0051641	0.883	cellular localization
GO:0008104	0.870	protein localization
GO:0032502	0.764	developmental process
GO:0048856	0.724	anatomical structure development
GO:0065007	0.521	biological regulation
GO:0050789	0.446	regulation of biological process
GO:0050794	0.377	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0016607	0.997	nuclear speck
GO:0031982	0.911	vesicle
GO:0031090	0.858	organelle membrane
GO:0031410	0.854	cytoplasmic vesicle
GO:0012505	0.845	endomembrane system
GO:0032991	0.537	protein-containing complex
GO:0071944	0.496	cell periphery
GO:0005886	0.463	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]