StarFunc result for job id Q9P2D6

User Input

>input (1515 residues)
MTEVQAMVEFSVELNKFYNVDLFQRGFYQIRASMKIPSRIPHRVEASLLHATGMTLAFPA
SVHDSLICSKTFQILYKNEEVVLNDVMIFKVKMLLDERKIEETLEEMNFLLSLDLHFTDG
DYSADDLNALQLISSRTLKLHFSPHRGLHHHVNVMFDYFHLSVVSVTVHASLVALHQPLI
SFPRPVKTTWLNRNAPAQNKDSVIPTLESVVFGINYTKQLSPDGCSFIIADSFLHHAYRF
HYTLCATLLLAFKGLHSYFITVTEEIPSCQKLELEEMDVEARLTELCEEVKKIENPDELA
ELINMNLAQLCSLLMALWGQFLEVITLHEELRILLAQEHHTLRVRRFSEAFFCFEHPREA
AIAYQELHAQSHLQMCTAIKNTSFCSSLPPLPIECSELDGDLNSLPIIFEDRYLDSVTED
LDAPWMGIQNLQRSESSKMDKYETEESSVAGLSSPELKVRPAGASSIWYTEGEKQLTKSL
KGKNEESNKSKVKVTKLMKTMKSENTKKLIKQNSKDSVVLVGYKCLKSTASNDLIKCFEG
NPSHSQKEGLDPTICGYNFDPKTYMRQTSQKEASCLPTNTERTEQKSPDIENVQPDQFDP
LNSGNLNLCANLSISGKLDISQDDSEITQMEHNLASRRSSDDCHDHQTTPSLGVRTIEIK
PSNKDPFSGENITVKLGPWTELRQEEILVDNLLPNFESLESNGKSKSIEITFEKEALQEA
KCLSIGESLTKLRSNLPAPSTKEYHVVVSGDTIKLPDISATYASSRFSDSGVESEPSSFA
THPNTDLVFETVQGQGPCNSERLFPQLLMKPDYNVKFSLGNHCTESTSAISEIQSSLTSI
NSLPSDDELSPDENSKKSVVPECHLNDSKTVLNLGTTDLPKCDDTKKSSITLQQQSVVFS
GNLDNETVAIHSLNSSIKDPLQFVFSDEETSSDVKSSCSSKPNLDTMCKGFQSPDKSNNS
TGTAITLNSKLICLGTPCVISGSISSNTDVSEDRTMKKNSDVLNLTQMYSEIPTVESETH
LGTSDPFSASTDIVKQGLVENYFGSQSSTDISDTCAVSYSNALSPQKETSEKEISNLQQE
QDKEDEEEEQDQQMVQNGYYEETDYSALDGTINAHYTSRDELMEERLTKSEKINSDYLRD
GINMPTVCTSGCLSFPSAPRESPCNVKYSSKSKFDAITKQPSSTSYNFTSSISWYESSPK
PQIQAFLQAKEELKLLKLPGFMYSEVPLLASSVPYFSVEEEDGSEDGVHLIVCVHGLDGN
SADLRLVKTYIELGLPGGRIDFLMSERNQNDTFADFDSMTDRLLDEIIQYIQIYSLTVSK
ISFIGHSLGNLIIRSVLTRPRFKYYLNKLHTFLSLSGPHLGTLYNSSALVNTGLWFMQKW
KKSGSLLQLTCRDHSDPRQTFLYKLSNKAGLHYFKNVVLVGSLQDRYVPYHSARIEMCKT
ALKDKQSGQIYSEMIHNLLRPVLQSKDCNLVRYNVINALPNTADSLIGRAAHIAVLDSEI
FLEKFFLVAALKYFQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q49AJ0	0.493	0.530	0.000	1406	0.388	0.418	Q49AJ0.pdb.gz	F135B_HUMAN Protein FAM135B OS=Homo sapiens OX=9606 GN=FAM135B PE=1 SV=2
2	PDB:1exwA	0.099	0.461	9.577E-7	279	0.027	0.147	1exwA.pdb.gz	Structural basis for the insensitivity of a serine enzyme (palmitoyl-protein thioesterase) to phenylmethylsulfonyl fluoride.
3	PDB:4e15B	0.108	0.400	1.045E-5	303	0.025	0.125	4e15B.pdb.gz
4	PDB:6ap6A	0.079	0.363	1.261E-4	264	0.020	0.117	6ap6A.pdb.gz	Inhibition of strigolactone receptors byN-phenylanthranilic acid derivatives: Structural and functional insights.
5	PDB:1vkhA	0.100	0.452	1.464E-4	261	0.022	0.126	1vkhA.pdb.gz
6	PDB:7lq1A	0.060	0.091	2.292E-4	950	0.037	0.059	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
7	PDB:4htaA	0.092	0.361	2.532E-4	271	0.026	0.144	4htaA.pdb.gz
8	PDB:4gdmC	0.085	0.379	2.940E-4	259	0.024	0.139	4gdmC.pdb.gz	Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
9	AFDB:A0A5F8MPU3	0.076	0.053	3.017E-4	2282	0.112	0.074	A0A5F8MPU3.pdb.gz	CTSRT_MOUSE Cation channel sperm-associated targeting subunit tau OS=Mus musculus OX=10090 GN=C2cd6 PE=1 SV=1
10	PDB:6eicB	0.099	0.445	3.248E-4	279	0.022	0.122	6eicB.pdb.gz
11	PDB:7tvwA	0.077	0.338	3.248E-4	265	0.020	0.113	7tvwA.pdb.gz
12	PDB:6fvjD	0.092	0.451	5.084E-4	223	0.017	0.117	6fvjD.pdb.gz	Biochemical and Structural Characterization of TesA, a Major Thioesterase Required for Outer-Envelope Lipid Biosynthesis in Mycobacterium tuberculosis.
13	AFDB:Q8N3D4	0.080	0.079	8.167E-4	1523	0.104	0.103	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
14	AFDB:Q8T498	0.073	0.071	1.101E-3	1580	0.124	0.119	Q8T498.pdb.gz	GAP2_DROME Ras GTPase-activating protein raskol OS=Drosophila melanogaster OX=7227 GN=raskol PE=1 SV=3
15	AFDB:Q9V9S7	0.071	0.061	1.485E-3	1866	0.096	0.078	Q9V9S7.pdb.gz	SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2
16	AFDB:Q86AT9	0.063	0.057	2.185E-2	1736	0.113	0.099	Q86AT9.pdb.gz	DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum OX=44689 GN=dhkI-1 PE=3 SV=1
17	AFDB:Q9VLS7	0.069	0.056	5.095E-2	2016	0.115	0.086	Q9VLS7.pdb.gz	Q9VLS7_DROME LD21067p OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=1 SV=1
18	AFDB:O81283	0.080	0.081	4.125E-1	1503	0.086	0.087	O81283.pdb.gz	TC159_ARATH Translocase of chloroplast 159, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC159 PE=1 SV=1
19	AFDB:A0A0B4JCZ8	0.031	0.025	7.499E-1	2028	0.097	0.072	A0A0B4JCZ8.pdb.gz	A0A0B4JCZ8_DROME Missing-in-metastasis, isoform F OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
20	AFDB:Q13023	0.032	0.023	9.151E-1	2319	0.110	0.072	Q13023.pdb.gz	AKAP6_HUMAN A-kinase anchor protein 6 OS=Homo sapiens OX=9606 GN=AKAP6 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q49AJ0	2.85e-164	535	1406	0.171	0.184	F135B_HUMAN Protein FAM135B OS=Homo sapiens OX=9606 GN=FAM135B PE=1 SV=2
2	Q147P6	1.27e-05	52.0	418	0.028	0.100	Q147P6_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g25770 PE=1 SV=1
3	Q08448	3.74e-05	50.4	450	0.034	0.116	LPL1_YEAST Lipid droplet phospholipase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LPL1 PE=1 SV=1
4	F4HZW3	2.04e-04	48.1	456	0.021	0.070	F4HZW3_ARATH Hydrolase-like protein family OS=Arabidopsis thaliana OX=3702 GN=UP9 PE=1 SV=1
5	P53118	2.75e-04	48.1	685	0.028	0.063	ROG1_YEAST Putative lipase ROG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ROG1 PE=1 SV=1
6	M9PC41	0.33	38.1	22743	0.028	0.002	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
7	M9PB30	0.38	38.1	22949	0.028	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
8	M9PB31	0.41	38.1	20404	0.028	0.002	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PB32	0.41	38.1	19560	0.028	0.002	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PBZ4	0.41	38.1	18014	0.028	0.002	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9PC45	0.42	37.7	22300	0.028	0.002	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PEH5	0.42	37.7	20710	0.028	0.002	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PEI1	0.42	37.7	21657	0.028	0.002	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PBZ0	0.43	37.7	22830	0.028	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9NER8	0.54	37.4	15638	0.028	0.003	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	M9PCJ8	0.58	37.4	14825	0.028	0.003	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9NCR4	0.62	37.4	15105	0.028	0.003	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	O14162	0.72	37.0	785	0.036	0.069	YE7A_SCHPO Putative lipase C4A8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4A8.10 PE=3 SV=2
19	Q71DJ5	4.2	34.3	393	0.011	0.043	LIP1_ARATH Triacylglycerol lipase 1 OS=Arabidopsis thaliana OX=3702 GN=LIP1 PE=1 SV=1
20	A0A068Q816	7.5	33.5	664	0.014	0.032	A0A068Q816_CHICK Histidine decarboxylase OS=Gallus gallus OX=9031 GN=HDC PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12394 DUF3657	3e-13	61.5	Protein FAM135
2	PF05057 DUF676	7.4e-58	207.2	Putative serine esterase (DUF676)
3	PF14851 FAM176	85	14.3	FAM176 family
4	PF02450 LCAT	2.5	18.8	Lecithin:cholesterol acyltransferase
5	PF02089 Palm_thioest	2.1e-05	36.0	Palmitoyl protein thioesterase
6	PF07819 PGAP1	0.067	24.5	PGAP1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000410768

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000288228	0.731	Protein FAM81A
2	9606.ENSP00000471516	0.601	Zinc finger protein 726
3	9606.ENSP00000295304	0.590	Glutathione-specific gamma-glutamylcyclotransferase 2
4	9606.ENSP00000288025	0.585	Transmembrane p24 trafficking protein 6
5	9606.ENSP00000365200	0.563	Testis-expressed protein 30
6	9606.ENSP00000365063	0.542	Protein ABHD13
7	9606.ENSP00000241051	0.530	DEP domain containing 7
8	9606.ENSP00000336693	0.522	Belongs to the serine esterase family
9	9606.ENSP00000273596	0.517	Protein ABHD14A
10	9606.ENSP00000383398	0.517	Beta-defensin 115
11	9606.ENSP00000358042	0.508	Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
12	9606.ENSP00000360166	0.505	Proline-rich protein 32
13	9606.ENSP00000237822	0.503	Lipid droplet-associated hydrolase
14	9606.ENSP00000482704	0.503	Dehydrogenase/reductase SDR family member 11
15	9606.ENSP00000273359	0.502	Mycophenolic acid acyl-glucuronide esterase, mitochondrial
16	9606.ENSP00000383901	0.502	Lipase member M

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.509	catalytic activity
GO:0016787	0.498	hydrolase activity
GO:0016788	0.432	hydrolase activity, acting on ester bonds

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.968	biological regulation
GO:0009987	0.958	cellular process
GO:0050789	0.935	regulation of biological process
GO:0050794	0.841	regulation of cellular process
GO:0071840	0.679	cellular component organization or biogenesis
GO:0016043	0.673	cellular component organization
GO:0006996	0.641	organelle organization
GO:0051179	0.581	localization
GO:0008152	0.506	metabolic process
GO:0071704	0.367	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005737	0.996	cytoplasm
GO:0005829	0.990	cytosol
GO:0043229	0.955	intracellular organelle
GO:0043227	0.920	membrane-bounded organelle
GO:0043232	0.678	intracellular non-membrane-bounded organelle
GO:0043231	0.665	intracellular membrane-bounded organelle
GO:0016020	0.371	membrane
GO:0031981	0.315	nuclear lumen
GO:0015630	0.308	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.498	Hydrolases.
EC:3.1.-.-	0.432	Acting on ester bonds.

[back to server]