StarFunc result for job id Q9P2D7

User Input

>input (1400 residues)
MEQPNSKGYSLGRTPQGPECSSAPAVQVGTHRGLEYNPGKILPGSDYGLGNPPALDPKLP
HLPLPPAPPTLSDLGQPRKSPLTGTDKKYPLMKQRGFYSDILSPGTLDQLGEVCRGPRMS
QNLLRQADLDKFTPRVGSFEVPEDFQERMEQQCIGSTTRLLAQTDFPLQAYEPKMQVPFQ
VLPGQHPRKIEIERRKQQYLSLDIEQLLFSQGIDSNKLMPRHLDHQHPQTIEQGHDPIFP
IYLPLKVFDNEDFDCRTPREWINMGLEPGSLDRKPVPGKALLPTDDFLGHEDPKSQKLKY
KWCEVGVLDYDEEKKLYLVHKTDEKGLVRDEMGRPILNAGVTTEGRPPLQVCQYWVPRIQ
LLFCAEDPCMFAQRVVQANALRKNTEALLLYNLYVDCMPSDGQHVISEQSLSKIKQWALS
TPRMRKGPSVLEHLSSLAREVSLDYERSMNKINFDHVVSSKPETFSYVTLPKKEEEQVPE
RGLVSVPKYHFWEQKEDFTFVSLLTRPEVITALSKVRAECNKVTAMSLFHSSLSKYSHLE
EFEQIQSQTFSQVQMFLKDSWISSLKVAMRSSLRDMSKGWYNLYETNWEVYLMSKLRKLM
ELVKYMLQDTLRFLVQDSLASFSQFISDTCCSVLNCTDDMVWGDDLINSPYRPRKNPLFI
MDLVLDSSGVHYSTPLEQFEASLLNLFDKGILATHAVPQLEKLVMEDIFISGDPLLESVG
LHEPLVEELRATIASAVSKAMIPLQAYAKEYRKYLELNNNDIASFLKTYQTQGLLAQEVR
EVVLTHLREKEILDSSLPSSIIIGPFYINTDNVKQSLSKKRKALATSVLDILAKNLHKEV
DSICEEFRSISRKIYEKPNSIEELAELREWMKGIPERLVGLEERIVKVMDDYQVMDEFLY
NLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVV
AGFSIHVEISRAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFSLPITNYDKLSRMVKEF
QPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFKDMPACQEV
ALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQD
HIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDTYILKSPDEASQLLDDH
IVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQL
PVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLET
KRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGE
EVQLCFSIYPSSNVEDWLRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VN30	0.330	0.421	9.997E-57	1079	0.191	0.247	Q9VN30.pdb.gz	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
2	PDB:7z8fe	0.218	0.070	1.924E-26	4579	0.124	0.038	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
3	PDB:7z8gA	0.220	0.105	5.606E-17	3047	0.072	0.033	7z8gA.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
4	PDB:7kzmC	0.199	0.077	6.620E-12	3890	0.132	0.048	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
5	PDB:5nugA	0.136	0.068	6.127E-10	2920	0.061	0.029	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
6	PDB:4w8fB	0.165	0.090	9.191E-9	2609	0.051	0.028	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.
7	PDB:7mi6A	0.168	0.098	1.345E-8	2419	0.051	0.030	7mi6A.pdb.gz	Targeting allostery in the Dynein motor domain with small molecule inhibitors.
8	AFDB:Q8JGN7	0.113	0.669	7.708E-6	202	0.036	0.248	Q8JGN7.pdb.gz
9	AFDB:Q9UPW8	0.056	0.049	1.778E-2	1703	0.095	0.078	Q9UPW8.pdb.gz	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
10	PDB:7ni5A	0.064	0.043	5.104E-2	2791	0.094	0.047	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
11	PDB:7wug5	0.049	0.082	5.324E-2	782	0.075	0.134	7wug5.pdb.gz
12	PDB:7r5jA0	0.049	0.080	5.794E-2	818	0.064	0.109	7r5jA0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	AFDB:Q5B4G0	0.036	0.070	7.496E-2	600	0.049	0.113	Q5B4G0.pdb.gz	Q5B4G0_EMENI RNA polymerase II transcription elongation factor Rtf1p, putative (AFU_orthologue AFUA_2G01900) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04570 PE=4 SV=1
14	AFDB:Q6ZP82	0.082	0.080	7.820E-2	1450	0.091	0.088	Q6ZP82.pdb.gz	CC141_HUMAN Coiled-coil domain-containing protein 141 OS=Homo sapiens OX=9606 GN=CCDC141 PE=1 SV=3
15	PDB:7usdA	0.066	0.074	8.847E-2	1185	0.087	0.103	7usdA.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
16	AFDB:Q9W542	0.046	0.056	1.194E-1	986	0.064	0.090	Q9W542.pdb.gz	Q9W542_DROME LD07342p OS=Drosophila melanogaster OX=7227 GN=mip130 PE=1 SV=3
17	AFDB:A0A1D8PLA4	0.050	0.055	1.902E-1	1196	0.123	0.144	A0A1D8PLA4.pdb.gz	A0A1D8PLA4_CANAL Zcf27p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ZCF27 PE=4 SV=1
18	AFDB:Q22000	0.044	0.068	2.252E-1	674	0.071	0.147	Q22000.pdb.gz	PDE4_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-4 OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=2 SV=2
19	AFDB:Q95YF0	0.044	0.044	2.350E-1	1378	0.076	0.077	Q95YF0.pdb.gz	CLAP1_CAEEL Protein CLASP-1 OS=Caenorhabditis elegans OX=6239 GN=cls-1 PE=3 SV=1
20	AFDB:Q9BL68	0.059	0.064	2.668E-1	1241	0.059	0.067	Q9BL68.pdb.gz	Q9BL68_CAEEL PIN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-6 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q8T7	0.0	2484	4250	0.866	0.285	DYH1_MOUSE Dynein axonemal heavy chain 1 OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1
2	Q384K3	0.0	657	4152	0.294	0.099	Q384K3_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0390 PE=4 SV=1
3	Q9P2D7	0.0	2906	4265	1.000	0.328	DYH1_HUMAN Dynein axonemal heavy chain 1 OS=Homo sapiens OX=9606 GN=DNAH1 PE=1 SV=6
4	Q38B68	8.29e-154	520	4142	0.249	0.084	Q38B68_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1720 PE=4 SV=1
5	Q8WXX0	1.15e-108	384	4024	0.176	0.061	DYH7_HUMAN Dynein axonemal heavy chain 7 OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2
6	Q9VN30	1.20e-102	355	1079	0.182	0.236	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
7	Q9VJC6	2.49e-102	364	4024	0.163	0.057	Q9VJC6_DROME Dynein heavy chain at 36C, isoform B OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=2
8	A0A6H2EJG3	2.99e-102	364	4065	0.163	0.056	A0A6H2EJG3_DROME Dynein heavy chain at 36C, isoform C OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=1
9	Q4AC22	4.58e-96	345	4149	0.144	0.049	Q4AC22_CHLRE Dynein heavy chain 9 OS=Chlamydomonas reinhardtii OX=3055 GN=DHC9 PE=1 SV=3
10	Q585U4	1.41e-87	318	4246	0.166	0.055	Q585U4_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.85 PE=4 SV=1
11	Q9VZ77	5.71e-80	295	4385	0.134	0.043	Q9VZ77_DROME Dynein, axonemal, heavy chain 3, isoform D OS=Drosophila melanogaster OX=7227 GN=Dnah3 PE=3 SV=3
12	E9Q3H7	1.54e-75	281	4092	0.169	0.058	E9Q3H7_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
13	E9Q0B6	1.86e-75	280	4144	0.169	0.057	E9Q0B6_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
14	Q9P225	9.69e-75	278	4427	0.161	0.051	DYH2_HUMAN Dynein axonemal heavy chain 2 OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3
15	P0C6F1	6.50e-72	269	4456	0.159	0.050	DYH2_MOUSE Dynein axonemal heavy chain 2 OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1
16	Q57VT8	1.31e-67	255	4112	0.124	0.042	Q57VT8_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.29K4.310 PE=4 SV=1
17	Q9MBF8	2.45e-66	251	4513	0.169	0.052	DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1
18	Q7KVA7	2.06e-64	245	3964	0.124	0.044	Q7KVA7_DROME Dynein heavy chain at 62B OS=Drosophila melanogaster OX=7227 GN=Dhc62B PE=3 SV=2
19	F7ABZ6	3.78e-63	241	4534	0.121	0.037	F7ABZ6_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
20	D3YYQ8	4.10e-63	241	4591	0.121	0.037	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08393 DHC_N2	1e-132	454.6	Dynein heavy chain, N-terminal region 2
2	PF02403 Seryl_tRNA_N	12	17.6	Seryl-tRNA synthetase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401514

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354791	0.941	Dynactin subunit 1
2	9606.ENSP00000380378	0.939	Platelet-activating factor acetylhydrolase IB subunit alpha
3	9606.ENSP00000479322	0.933	CAP-Gly domain-containing linker protein 1
4	9606.ENSP00000408910	0.923	Dynactin subunit 2
5	9606.ENSP00000261383	0.919	Dynein heavy chain 3, axonemal
6	9606.ENSP00000265104	0.917	Dynein heavy chain 5, axonemal
7	9606.ENSP00000374045	0.915	Dynein heavy chain 6, axonemal
8	9606.ENSP00000333363	0.910	Dynein heavy chain 8, axonemal
9	9606.ENSP00000312554	0.909	Dynein axonemal heavy chain 12
10	9606.ENSP00000383737	0.909	Dynein axonemal heavy chain 14
11	9606.ENSP00000259632	0.901	Dynactin subunit 3
12	9606.ENSP00000221114	0.900	Dynactin subunit 6
13	9606.ENSP00000400252	0.898	Dynein intermediate chain 2, axonemal
14	9606.ENSP00000480538	0.876	Dynein intermediate chain 1, axonemal
15	9606.ENSP00000318429	0.872	Coiled-coil domain-containing protein 114
16	9606.ENSP00000373948	0.836	Cilia- and flagella-associated protein 69
17	9606.ENSP00000289228	0.826	Beta-centractin
18	9606.ENSP00000254286	0.820	Actin related protein 10 homolog
19	9606.ENSP00000358921	0.820	Alpha-centractin
20	9606.ENSP00000349568	0.811	Cilia and flagella associated protein 43

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003777	1.000	microtubule motor activity
GO:0005488	0.998	binding
GO:0005515	0.994	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0003341	0.977	cilium movement
GO:0030317	0.968	flagellated sperm motility
GO:0000226	0.882	microtubule cytoskeleton organization
GO:0070925	0.856	organelle assembly
GO:0035082	0.851	axoneme assembly
GO:0032501	0.743	multicellular organismal process
GO:0120316	0.728	sperm flagellum assembly
GO:0070286	0.304	axonemal dynein complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031514	0.999	motile cilium
GO:0005737	0.996	cytoplasm
GO:0043229	0.996	intracellular organelle
GO:0097729	0.993	9+2 motile cilium
GO:0005856	0.990	cytoskeleton
GO:0036126	0.964	sperm flagellum
GO:0032991	0.924	protein-containing complex
GO:0015630	0.840	microtubule cytoskeleton
GO:0099568	0.803	cytoplasmic region
GO:0032838	0.742	plasma membrane bounded cell projection cytoplasm
GO:0097014	0.679	ciliary plasm
GO:1902494	0.597	catalytic complex
GO:0005930	0.527	axoneme
GO:0030286	0.526	dynein complex
GO:0005858	0.430	axonemal dynein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]