StarFunc result for job id Q9P2D8

User Input

>input (2635 residues)
MSTKAEQFASKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSILSRTGKKENQD
ASNLTVPMTMCLFPVPFPLTPSLRPQVSSINPTVTRSLLYSVLRDAPSERGPQSRDAQLS
DYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLNDDILSTLPYTMIS
TLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGVPAHVNLSASSMLMIAMQYTSNPVYH
CQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYRGLQYTA
WNPIHCQHIECHNAINKPAVKMCIDPSLSVALGDKPPPLYLCEECSERIAGDHSEWLIDV
LLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGAAA
ETHLYQTSPPPINTRECGAEELVCAVEAVISLLKEAEFHAEQREHELNRRRQLGLSSSHH
SLDNADFDNKDDDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYM
MDDEVGSLVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQL
KEGLNRILCLIPYNVINQSVWECIMPEWLEAIRTEVPDNQLKEFREVLSKMFDIELCPLP
FSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVKELAN
QRKSRVSELAGNLASRRVSVASDPGRRVQHNMLSPFHSPFQSPFRSPLRSPFRSPFKNFG
HPGGRTIDFDCEDDEMNLNCFILMFDLLLKQMELQDDGITMGLEHSLSKDIISIINNVFQ
APWGGSHTCQKDEKAIECNLCQSSILCYQLACELLERLAPKEESRLVEPTDSLEDSLLSS
RPEFIIGPEGEEEENPASKHGENPGNCTEPVEHAAVKNDTERKFCYQQLPVTLRLIYTIF
QEMAKFEEPDILFNMLNCLKILCLHGECLYIARKDHPQFLAYIQDHMLIASLWRVVKSEF
SQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVT
KNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKD
RPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFPTTITAVRTNV
ANLSDAALWKIKRARFARNRQKSVRSLRDSVKGPVESKRALSLPETLTSKIRQQSPENDN
TIKDLLPEDAGIDHQTVHQLITVLMKFMAKDESSAESDISSAKAFNTVKRHLYVLLGYDQ
QEGCFMIAPQKMRLSTCFNAFIAGIAQVMDYNINLGKHLLPLVVQVLKYCSCPQLRHYFQ
QPPRCSLWSLKPHIRQMWLKALLVILYKYPYRDCDISKILLHLIHITVNTLNAQYHSCKP
HATAGPLYSDNSNISRYSEKEKGEIELAEYRETGALQDSLLHCVREESIPKKKLRSFKQK
SLDIGNADSLLFTLDEHRRKSCIDRCDIEKPPTQAAYIAQRPNDPGRSRQNSATRPDNSE
IPENPAMEGFPDARRPVIPEVRLNCMETFEVKVDSPVKPAPKEDLDLIDLSSDSTSGPEK
HSILSTSDSDSLVFEPLPPLRIVESDEEEETMNQGDDGPSGKNAASSPSVPSHPSVLSLS
TAPLVQVSVEDCSKDFSSKDSGNNQSAGNTDSALITLEDPMDAEGSSKPEELPEFSCGSP
LTLKQKRDLLQKSFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTES
EKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSAIQREYLDISFNIL
DKLGEQKDPDPSTKGLSTLEMPRESSSAPTLDAGVPETSSHSSISTQYRQMKRGSLGVLT
MSQLMKRQLEHQSSAPHNISNWDTEQIQPGKRQCNVPTCLNPDLEGQPLRMRGATKSSLL
SAPSIVSMFVPAPEEFTDEQPTVMTDKCHDCGAILEEYDEETLGLAIVVLSTFIHLSPDL
AAPLLLDIMQSVGRLASSTTFSNQAESMMVPGNAAGVAKQFLRCIFHQLAPNGIFPQLFQ
STIKDGTFLRTLASSLMDFNELSSIAALSQLLEGLNNKKNLPAGGAMIRCLENIATFMEA
LPMDSPSSLWTTISNQFQTFFAKLPCVLPLKCSLDSSLRIMICLLKIPSTNATRSLLEPF
SKLLSFVIQNAVFTLAYLVELCGLCYRAFTKERDKFYLSRSVVLELLQALKLKSPLPDTN
LLLLVQFICADAGTKLAESTILSKQMIASVPGCGTAAMECVRQYINEVLDFMADMHTLTK
LKSHMKTCSQPLHEDTFGGHLKVGLAQIAAMDISRGNHRDNKAVIRYLPWLYHPPSAMQQ
GPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASSPCLPIPLDAGSHVADHLIVILIGFPE
QSKTSVLHMCSLFHAFIFAQLWTVYCEQSAVATNLQNQNEFSFTAILTALEFWSRVTPSI
LQLMAHNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNIKHLSAGLQLRLQ
AIQNHVNHHSLRTLPGSGQSSAGLAALRKWLQCTQFKMAQVEIQSSEAASQFYPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7sx3D	0.212	0.367	0.000	1418	0.507	0.942	7sx3D.pdb.gz	Structural architecture of the human NALCN channelosome.
2	PDB:7wjiB	0.284	0.432	0.000	1663	0.629	0.996	7wjiB.pdb.gz
3	AFDB:Q0KK59	0.547	0.554	0.000	2596	0.941	0.955	Q0KK59.pdb.gz	UNC79_MOUSE Protein unc-79 homolog OS=Mus musculus OX=10090 GN=Unc79 PE=1 SV=1
4	AFDB:Q9P2D8	1.000	1.000	0.000	2635	1.000	1.000	Q9P2D8.pdb.gz	UNC79_HUMAN Protein unc-79 homolog OS=Homo sapiens OX=9606 GN=UNC79 PE=1 SV=4
5	AFDB:E1C2U2	0.094	0.100	1.458E-6	2326	0.087	0.098	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
6	AFDB:Q5UIP0	0.086	0.090	2.743E-5	2472	0.079	0.084	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
7	PDB:7mqaSP	0.109	0.113	1.719E-4	2485	0.064	0.068	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:7ajuUT	0.088	0.098	3.648E-4	2313	0.053	0.060	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
9	AFDB:Q68CQ1	0.056	0.094	4.609E-4	1323	0.062	0.123	Q68CQ1.pdb.gz	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
10	AFDB:F4K0Y5	0.064	0.103	4.786E-4	1165	0.053	0.119	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
11	AFDB:Q9P789	0.056	0.107	4.786E-4	1065	0.066	0.164	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2
12	PDB:7kzvV	0.069	0.108	4.929E-4	1155	0.034	0.078	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
13	PDB:7sglA	0.097	0.083	5.518E-4	3852	0.099	0.068	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
14	PDB:4a0cA	0.079	0.149	5.950E-4	1155	0.055	0.125	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
15	AFDB:Q2QCI8	0.060	0.069	1.016E-3	2173	0.096	0.116	Q2QCI8.pdb.gz	MED12_DANRE Mediator of RNA polymerase II transcription subunit 12 OS=Danio rerio OX=7955 GN=med12 PE=2 SV=1
16	AFDB:Q7Z5K2	0.065	0.106	1.055E-3	1190	0.056	0.124	Q7Z5K2.pdb.gz	WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1
17	AFDB:F4J8G7	0.104	0.122	1.372E-3	2138	0.104	0.129	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
18	PDB:3gjxA	0.080	0.169	1.414E-3	1041	0.033	0.083	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
19	PDB:6xu2A	0.076	0.144	1.468E-3	1091	0.030	0.071	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
20	PDB:3gb8A	0.078	0.167	1.582E-3	958	0.032	0.089	3gb8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0KK59	0.0	5058	2596	0.942	0.956	UNC79_MOUSE Protein unc-79 homolog OS=Mus musculus OX=10090 GN=Unc79 PE=1 SV=1
2	Q9P2D8	0.0	5461	2635	1.000	1.000	UNC79_HUMAN Protein unc-79 homolog OS=Homo sapiens OX=9606 GN=UNC79 PE=1 SV=4
3	E1JIQ0	5.57e-176	570	943	0.127	0.354	E1JIQ0_DROME FI18806p1 OS=Drosophila melanogaster OX=7227 GN=unc79 PE=2 SV=1
4	A0A0B4LHB4	7.16e-165	573	2781	0.127	0.120	A0A0B4LHB4_DROME Uncoordinated 79, isoform F OS=Drosophila melanogaster OX=7227 GN=unc79 PE=4 SV=1
5	A0A0B4LID2	7.60e-165	573	2783	0.127	0.120	A0A0B4LID2_DROME Uncoordinated 79, isoform E OS=Drosophila melanogaster OX=7227 GN=unc79 PE=4 SV=1
6	Q06AJ1	9.65e-165	573	2765	0.127	0.121	Q06AJ1_DROME DUNC79 OS=Drosophila melanogaster OX=7227 GN=unc79 PE=2 SV=1
7	E1JIP9	9.77e-165	573	2776	0.127	0.120	E1JIP9_DROME Uncoordinated 79, isoform B OS=Drosophila melanogaster OX=7227 GN=unc79 PE=4 SV=1
8	Q9VDY5	1.91e-164	573	3028	0.127	0.110	Q9VDY5_DROME Uncoordinated 79, isoform C OS=Drosophila melanogaster OX=7227 GN=unc79 PE=4 SV=3
9	Q961X5	4.18e-124	409	638	0.100	0.414	Q961X5_DROME GH01039p OS=Drosophila melanogaster OX=7227 GN=unc79 PE=2 SV=1
10	P42173	1.40e-119	404	870	0.087	0.263	UNC79_CAEEL Uncoordinated protein 79 OS=Caenorhabditis elegans OX=6239 GN=unc-79 PE=4 SV=3
11	G5ECI9	4.38e-113	405	2092	0.087	0.109	G5ECI9_CAEEL Uncoordinated protein 79 OS=Caenorhabditis elegans OX=6239 GN=unc-79 PE=4 SV=1
12	Q59W62	0.032	42.4	1349	0.009	0.018	GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GIN4 PE=1 SV=1
13	Q384W0	0.13	40.0	523	0.014	0.069	Q384W0_TRYB2 Cilium assembly protein DZIP1 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4960 PE=4 SV=1
14	Q7Z465	0.41	38.1	357	0.012	0.087	BNIPL_HUMAN Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein OS=Homo sapiens OX=9606 GN=BNIPL PE=1 SV=1
15	Q9Y7J0	0.64	37.4	376	0.011	0.080	NPY1_SCHPO NAD-capped RNA hydrolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1778.03c PE=3 SV=1
16	Q55GW5	0.75	37.7	979	0.008	0.022	Q55GW5_DICDI Nuclear pore protein OS=Dictyostelium discoideum OX=44689 GN=nup93 PE=3 SV=1
17	A0A0B4KI06	2.2	36.2	3930	0.014	0.009	A0A0B4KI06_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
18	A0A0B4LIK5	2.2	36.2	3921	0.014	0.010	A0A0B4LIK5_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
19	Q8IMW2	2.2	36.2	3912	0.014	0.010	Q8IMW2_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=2
20	Q9VC56	2.2	36.2	3912	0.014	0.010	PUF_DROME Ubiquitin carboxyl-terminal hydrolase puf OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09963 DUF2197	2.7e+02	13.2	Uncharacterized protein conserved in bacteria (DUF2197)
2	PF14776 UNC-79	3.9e-170	578.6	Cation-channel complex subunit UNC-79

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000011362

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000022009	0.987	Uncharacterized protein
2	9598.ENSPTRP00000010208	0.917	Sodium leak channel, non-selective
3	9598.ENSPTRP00000000663	0.786	Uncharacterized protein
4	9598.ENSPTRP00000002923	0.786	Voltage-dependent R-type calcium channel subunit alpha
5	9598.ENSPTRP00000003055	0.786	Voltage-dependent L-type calcium channel subunit alpha
6	9598.ENSPTRP00000006871	0.786	Two pore segment channel 2
7	9598.ENSPTRP00000007742	0.786	Voltage-dependent L-type calcium channel subunit alpha
8	9598.ENSPTRP00000009308	0.786	Two pore segment channel 1
9	9598.ENSPTRP00000011959	0.786	Cation channel, sperm associated 2
10	9598.ENSPTRP00000016195	0.786	Sodium channel protein
11	9598.ENSPTRP00000021517	0.786	Sodium channel protein
12	9598.ENSPTRP00000021521	0.786	Sodium channel protein
13	9598.ENSPTRP00000025458	0.786	Sodium channel protein
14	9598.ENSPTRP00000025462	0.786	Sodium channel, voltage-gated, type XI, alpha subunit
15	9598.ENSPTRP00000025959	0.786	Voltage-dependent L-type calcium channel subunit alpha
16	9598.ENSPTRP00000029512	0.786	Cation channel, sperm associated 3
17	9598.ENSPTRP00000037005	0.786	Voltage-dependent N-type calcium channel subunit alpha
18	9598.ENSPTRP00000037582	0.786	Calcium voltage-gated channel subunit alpha1 F
19	9598.ENSPTRP00000041566	0.786	Sodium channel protein
20	9598.ENSPTRP00000042161	0.786	Sodium channel, voltage gated, type VIII, alpha subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0040007	0.970	growth
GO:0032501	0.967	multicellular organismal process
GO:0048589	0.938	developmental growth
GO:0035264	0.917	multicellular organism growth
GO:0050896	0.908	response to stimulus
GO:1901700	0.900	response to oxygen-containing compound
GO:0097305	0.824	response to alcohol
GO:0045471	0.814	response to ethanol
GO:0007610	0.791	behavior
GO:0030534	0.488	adult behavior
GO:0009987	0.422	cellular process
GO:0065007	0.325	biological regulation
GO:0050789	0.320	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.882	intracellular anatomical structure
GO:0005737	0.754	cytoplasm
GO:0043226	0.734	organelle
GO:0043227	0.453	membrane-bounded organelle
GO:0043229	0.450	intracellular organelle
GO:0043231	0.358	intracellular membrane-bounded organelle
GO:0005829	0.305	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]