StarFunc result for job id Q9P2E2

User Input

>input (1029 residues)
MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAADEPPKQFTFDGAYHV
DHVTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGLPDPPSQRGIIPRAFEH
VFESVQCAENTKFLVRASYLEIYNEDVRDLLGADTKQKLELKEHPEKGVYVKGLSMHTVH
SVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSAVDERGKDHLRAGKLNLVD
LAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHVPYRDSKLTRLLQDSL
GGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPRINEDPKDALLREYQEEIKKL
KAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQHDVEAEKQLIREEYEERLARL
KADYKAEQESRARLEEDITAMRNSYDVRLSTLEENLRKETEAVLQVGVLYKAEVMSRAEF
ASSAEYPPAFQYETVVKPKVFSTTDTLPSDDVSKTQVSSRFAELPKVEPSKSEISLGSSE
SSSLEETSVSEAFPGPEEPSNVEVSMPTEESRSRYFLDECLGQEAAGHLLGEQNYLPQEE
PQEVPLQGLLGLQDPFAEVEAKLARLSSTVARTDAPQADVPKVPVQVPAPTDLLEPSDAR
PEAEAADDFPPRPEVDLASEVALEVVRTAEPGVWLEAQAPVALVAQPEPLPATAGVKRES
VGMEVAVLTDDPLPVVDQQQVLARLQLLEQQVVGGEQAKNKDLKEKHKRRKRYADERRKQ
LVAALQNSDEDSGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEK
IDYLATIRRQERDSMLLQQLLEQVQPLIRRDCNYSNLEKILRESCWDEDNGFWKIPHPVI
TKTSLPVAVSTGPQNKPARKTSAADNGEPNMEDDRYRLMLSRSNSENIASNYFRSKRASQ
ILSTDARKSLTHHNSPPGLSCPLSNNSAIPPTQAPEMPQPRPFRLESLDIPFTKAKRKKS
KSNFGSEPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99PW8	0.407	0.404	0.000	1038	0.807	0.800	Q99PW8.pdb.gz	KIF17_MOUSE Kinesin-like protein KIF17 OS=Mus musculus OX=10090 GN=Kif17 PE=1 SV=1
2	AFDB:Q9P2E2	1.000	1.000	0.000	1029	1.000	1.000	Q9P2E2.pdb.gz	KIF17_HUMAN Kinesin-like protein KIF17 OS=Homo sapiens OX=9606 GN=KIF17 PE=2 SV=3
3	AFDB:C0L098	0.379	0.468	1.945E-86	823	0.486	0.608	C0L098.pdb.gz
4	AFDB:P46873	0.379	0.550	3.389E-65	699	0.345	0.508	P46873.pdb.gz	OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans OX=6239 GN=osm-3 PE=1 SV=4
5	AFDB:Q19633	0.364	0.476	4.036E-54	782	0.279	0.367	Q19633.pdb.gz	Q19633_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=klp-11 PE=1 SV=2
6	AFDB:Q965T6	0.380	0.593	4.210E-52	646	0.259	0.412	Q965T6.pdb.gz	KLP20_CAEEL Kinesin-like protein klp-20 OS=Caenorhabditis elegans OX=6239 GN=klp-20 PE=1 SV=1
7	AFDB:Q57ZS8	0.345	0.327	2.286E-46	1088	0.171	0.162	Q57ZS8.pdb.gz	Q57ZS8_TRYB2 OSM3-like kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.1P6.90 PE=3 SV=1
8	AFDB:P33174	0.329	0.276	5.121E-40	1231	0.184	0.154	P33174.pdb.gz	KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3
9	AFDB:Q8GW44	0.314	0.684	8.230E-39	465	0.149	0.329	Q8GW44.pdb.gz	KN1_ARATH Kinesin-like protein KIN-1 OS=Arabidopsis thaliana OX=3702 GN=KIN1 PE=1 SV=1
10	AFDB:Q57V46	0.316	0.553	1.116E-37	578	0.138	0.246	Q57V46.pdb.gz	Q57V46_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.490 PE=3 SV=1
11	PDB:7wrgA	0.310	0.391	1.322E-35	812	0.144	0.182	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.302	0.395	1.634E-33	783	0.139	0.183	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.270	0.408	4.186E-26	670	0.107	0.164	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:5j6hA	0.047	0.132	2.110E-2	275	0.024	0.091	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
15	PDB:7w85A	0.050	0.093	4.409E-2	435	0.022	0.053	7w85A.pdb.gz
16	PDB:4fe9A	0.052	0.104	6.938E-2	446	0.019	0.045	4fe9A.pdb.gz	Multidomain Carbohydrate-binding Proteins Involved in Bacteroides thetaiotaomicron Starch Metabolism.
17	PDB:2jmuA	0.062	0.189	1.534E-1	224	0.023	0.107	2jmuA.pdb.gz
18	PDB:6e1iA	0.059	0.116	1.623E-1	389	0.021	0.057	6e1iA.pdb.gz
19	PDB:5svan	0.035	0.085	1.818E-1	200	0.017	0.090	5svan.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
20	PDB:5kynA	0.060	0.071	2.036E-1	730	0.036	0.051	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QV34	0.0	720	823	0.322	0.402	F1QV34_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=kif17 PE=3 SV=1
2	Q99PW8	0.0	1649	1038	0.807	0.800	KIF17_MOUSE Kinesin-like protein KIF17 OS=Mus musculus OX=10090 GN=Kif17 PE=1 SV=1
3	Q9P2E2	0.0	2113	1029	1.000	1.000	KIF17_HUMAN Kinesin-like protein KIF17 OS=Homo sapiens OX=9606 GN=KIF17 PE=2 SV=3
4	P46873	4.17e-178	537	699	0.263	0.388	OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans OX=6239 GN=osm-3 PE=1 SV=4
5	O15066	1.38e-157	486	747	0.223	0.307	KIF3B_HUMAN Kinesin-like protein KIF3B OS=Homo sapiens OX=9606 GN=KIF3B PE=1 SV=1
6	Q61771	1.44e-156	483	747	0.222	0.305	KIF3B_MOUSE Kinesin-like protein KIF3B OS=Mus musculus OX=10090 GN=Kif3b PE=1 SV=1
7	D3ZI07	2.96e-156	482	747	0.221	0.304	D3ZI07_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3b PE=3 SV=1
8	P46871	1.03e-153	475	742	0.221	0.306	KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP95 PE=1 SV=1
9	A0A0G2JUD6	9.21e-153	471	701	0.222	0.325	A0A0G2JUD6_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=2
10	A0A8I6GCQ1	1.17e-152	470	674	0.222	0.338	A0A8I6GCQ1_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
11	A0A8I6AL48	1.29e-152	471	684	0.222	0.333	A0A8I6AL48_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
12	P28741	1.41e-152	471	701	0.222	0.325	KIF3A_MOUSE Kinesin-like protein KIF3A OS=Mus musculus OX=10090 GN=Kif3a PE=1 SV=2
13	E9QB71	1.80e-152	471	701	0.223	0.327	E9QB71_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=fc55h04 PE=1 SV=1
14	Q9Y496	2.01e-152	471	699	0.220	0.323	KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens OX=9606 GN=KIF3A PE=1 SV=4
15	A0A8I6AP89	2.51e-152	470	686	0.222	0.332	A0A8I6AP89_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
16	F1LQZ3	3.22e-152	471	726	0.222	0.314	F1LQZ3_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=3
17	F1QN54	1.52e-149	466	775	0.216	0.286	KIF3B_DANRE Kinesin-like protein KIF3B OS=Danio rerio OX=7955 GN=kif3b PE=2 SV=1
18	P46869	7.72e-148	461	786	0.236	0.309	FLA10_CHLRE Kinesin-like protein FLA10 OS=Chlamydomonas reinhardtii OX=3055 GN=FLA10 PE=1 SV=1
19	P46872	4.10e-147	457	699	0.212	0.312	KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP85 PE=1 SV=1
20	Q19633	5.20e-144	451	782	0.227	0.299	Q19633_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=klp-11 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.4e+02	14.3	AAA ATPase domain
2	PF13401 AAA_22	6.1e+02	12.1	AAA domain
3	PF00225 Kinesin	2.4e-114	393.4	Kinesin motor domain
4	PF16183 Kinesin_assoc	75	15.0	Kinesin-associated
5	PF16796 Microtub_bd	3.1e-19	80.9	Microtubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000247986

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265381	0.996	Amyloid-beta A4 precursor protein-binding family A member 1
2	9606.ENSP00000336712	0.994	Transportin-1
3	9606.ENSP00000265372	0.970	cAMP responsive element modulator
4	9606.ENSP00000384863	0.969	Exportin-1
5	9606.ENSP00000326022	0.960	Four and a half LIM domains protein 5
6	9606.ENSP00000477455	0.939	Glutamate receptor ionotropic, NMDA 2B
7	9606.ENSP00000447488	0.927	Protein lin-7 homolog A
8	9606.ENSP00000386181	0.923	Tetratricopeptide repeat protein 30B
9	9606.ENSP00000367408	0.919	Peripheral plasma membrane protein CASK
10	9606.ENSP00000333496	0.904	Potassium voltage-gated channel subfamily D member 2
11	9606.ENSP00000354560	0.901	Kinesin-associated protein 3
12	9606.ENSP00000419279	0.897	Intraflagellar transport protein 56
13	9606.ENSP00000397026	0.888	Glutamate receptor ionotropic, kainate 2
14	9606.ENSP00000362121	0.881	Intraflagellar transport protein 52 homolog
15	9606.ENSP00000260570	0.872	Intraflagellar transport protein 172 homolog
16	9606.ENSP00000323580	0.863	Intraflagellar transport protein 88 homolog
17	9606.ENSP00000363480	0.863	Disks large homolog 3
18	9606.ENSP00000260731	0.858	Kinesin-like protein KIF11
19	9606.ENSP00000381167	0.854	Cytoplasmic dynein 2 heavy chain 1
20	9606.ENSP00000264538	0.852	Intraflagellar transport protein 57 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003777	1.000	microtubule motor activity
GO:0019899	0.391	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0071840	0.973	cellular component organization or biogenesis
GO:0016043	0.962	cellular component organization
GO:0007017	0.933	microtubule-based process
GO:0051179	0.930	localization
GO:0006996	0.908	organelle organization
GO:0030705	0.851	cytoskeleton-dependent intracellular transport
GO:0007018	0.830	microtubule-based movement
GO:0099111	0.793	microtubule-based transport
GO:0010970	0.770	transport along microtubule
GO:0065007	0.757	biological regulation
GO:0031503	0.749	protein-containing complex localization
GO:0030030	0.730	cell projection organization
GO:0044782	0.699	cilium organization
GO:0050794	0.600	regulation of cellular process
GO:0044085	0.383	cellular component biogenesis
GO:0042073	0.363	intraciliary transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	1.000	cilium
GO:0005829	0.999	cytosol
GO:0043229	0.995	intracellular organelle
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0032991	0.950	protein-containing complex
GO:0015630	0.889	microtubule cytoskeleton
GO:0005815	0.634	microtubule organizing center
GO:0043231	0.629	intracellular membrane-bounded organelle
GO:0016020	0.380	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]