StarFunc result for job id Q9P2E3

User Input

>input (1918 residues)
MEERRPHLDARPRNSHTNHRGPVDGELPPRARNQANNPPANALRGGASHPGRHPRANNHP
AAYWQREERFRAMGRNPHQGRRNQEGHASDEARDQRHDQENDTRWRNGNQDCRNRRPPWS
NDNFQQWRTPHQKPTEQPQQAKKLGYKFLESLLQKDPSEVVITLATSLGLKELLSHSSMK
SNFLELICQVLRKACSSKMDRQSVLHVLGILKNSKFLKVCLPAYVVGMITEPIPDIRNQY
PEHISNIISLLQDLVSVFPASSVQETSMLVSLLPTSLNALRASGVDIEEETEKNLEKVQT
IIEHLQEKRREGTLRVDTYTLVQPEAEDHVESYRTMPIYPTYNEVHLDERPFLRPNIISG
KYDSTAIYLDTHFRLLREDFVRPLREGILELLQSFEDQGLRKRKFDDIRIYFDTRIITPM
CSSSGIVYKVQFDTKPLKFVRWQNSKRLLYGSLVCMSKDNFETFLFATVSNREQEDLCRG
IVQLCFNEQSQQLLAEVQPSDSFLMVETTAYFEAYRHVLEGLQEVQEEDVPFQRNIVECN
SHVKEPRYLLMGGRYDFTPLIENPSATGEFLRNVEGLRHPRINVLDPGQWPSKEALKLDD
SQMEALQFALTRELAIIQGPPGTGKTYVGLKIVQALLTNESVWQISLQKFPILVVCYTNH
ALDQFLEGIYNCQKTSIVRVGGRSNSEILKQFTLRELRNKREFRRNLPMHLRRAYMSIMT
QMKESEQELHEGAKTLECTMRGVLREQYLQKYISPQHWESLMNGPVQDSEWICFQHWKHS
MMLEWLGLGVGSFTQSVSPAGPENTAQAEGDEEEEGEEESSLIEIAEEADLIQADRVIEE
EEVVRPQRRKKEESGADQELAKMLLAMRLDHCGTGTAAGQEQATGEWQTQRNQKKKMKKR
VKDELRKLNTMTAAEANEIEDVWQLDLSSRWQLYRLWLQLYQADTRRKILSYERQYRTSA
ERMAELRLQEDLHILKDAQVVGMTTTGAAKYRQILQKVEPRIVIVEEAAEVLEAHTIATL
SKACQHLILIGDHQQLRPSANVYDLAKNFNLEVSLFERLVKVNIPFVRLNYQHRMCPEIA
RLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAHFVVEL
CKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKTFAGVRVHVVDKYQGEENDIILLSLV
RSNQEGKVGFLQISNRICVALSRAKKGMYCIGNMQMLAKVPLWSKIIHTLRENNQIGPML
RLCCQNHPETHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPYDSSHKEFQCMK
PCQKVICQEGHRCPLVCFQECQPCQVKVPKTIPRCGHEQMVPCSVPESDFCCQEPCSKSL
RCGHRCSHPCGEDCVQLCSEMVTIKLKCGHSQPVKCGHVEGLLYGGLLVKCTTKCGTILD
CGHPCPGSCHSCFEGRFHERCQQPCKRLLICSHKCQEPCIGECPPCQRTCQNRCVHSQCK
KKCGELCSPCVEPCVWRCQHYQCTKLCSEPCNRPPCYVPCTKLLVCGHPCIGLCGEPCPK
KCRICHMDEVTQIFFGFEDEPDARFVQLEDCSHIFEVQALDRYMNEQKDDEVAIRLKVCP
ICQVPIRKNLRYGTSIKQRLEEIEIIKEKIQGSAGEIATSQERLKALLERKSLLHQLLPE
DFLMLKEKLAQKNLSVKDLGLVENYISFYDHLASLWDSLKKMHVLEEKRVRTRLEQVHEW
LAKKRLSFTSQELSDLRSEIQRLTYLVNLLTRYKIAEKKVKDSIAVEVYSVQNILEKTCK
FTQEDEQLVQEKMEALKATLPCSGLGISEEERVQIVSAIGYPRGHWFKCRNGHIYVIGDC
GGAMERGTCPDCKEVIGGTNHTLERSNQLASEMDGAQHAAWSDTANNLMNFEEIQGMM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2E3	1.000	1.000	0.000	1918	1.000	1.000	Q9P2E3.pdb.gz	ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=ZNFX1 PE=1 SV=2
2	AFDB:Q92355	0.257	0.289	1.905E-31	1687	0.102	0.116	Q92355.pdb.gz	SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sen1 PE=1 SV=1
3	PDB:4pj3A	0.279	0.386	2.776E-30	1335	0.116	0.166	4pj3A.pdb.gz	The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes.
4	AFDB:Q6ZQJ5	0.239	0.410	2.215E-25	1062	0.070	0.126	Q6ZQJ5.pdb.gz	DNA2_MOUSE DNA replication ATP-dependent helicase/nuclease DNA2 OS=Mus musculus OX=10090 GN=Dna2 PE=1 SV=2
5	PDB:5eanA	0.237	0.402	5.775E-24	1051	0.077	0.141	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
6	PDB:3jb9X	0.260	0.394	2.757E-16	1195	0.084	0.135	3jb9X.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
7	PDB:1w36B	0.132	0.206	7.929E-6	1158	0.047	0.078	1w36B.pdb.gz	Crystal Structure of Recbcd Enzyme Reveals a Machine for Processing DNA Breaks
8	PDB:7zelA	0.085	0.182	1.085E-5	827	0.021	0.048	7zelA.pdb.gz	Mechanistic understanding of human SLFN11.
9	PDB:4cejA	0.108	0.167	3.176E-5	1177	0.055	0.090	4cejA.pdb.gz	Structural Basis for Translocation by Addab Helicase-Nuclease and its Arrest at Chi Sites.
10	PDB:3u44A	0.112	0.183	3.473E-5	1122	0.054	0.092	3u44A.pdb.gz	Insights into Chi recognition from the structure of an AddAB-type helicase-nuclease complex.
11	PDB:2is4B	0.135	0.375	8.503E-5	632	0.044	0.133	2is4B.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
12	PDB:1uaaA	0.129	0.352	1.591E-4	636	0.043	0.129	1uaaA.pdb.gz	Major domain swiveling revealed by the crystal structures of complexes of E. coli Rep helicase bound to single-stranded DNA and ADP.
13	PDB:2is6A	0.132	0.353	1.990E-4	654	0.043	0.125	2is6A.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
14	AFDB:P40798	0.048	0.074	2.621E-4	1106	0.059	0.103	P40798.pdb.gz	STC_DROME Protein shuttle craft OS=Drosophila melanogaster OX=7227 GN=stc PE=1 SV=2
15	AFDB:P51532	0.130	0.148	1.126E-2	1647	0.072	0.084	P51532.pdb.gz	SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2
16	AFDB:Q9SIC9	0.047	0.084	3.152E-2	918	0.031	0.064	Q9SIC9.pdb.gz	PP178_ARATH Pentatricopeptide repeat-containing protein GUN1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GUN1 PE=2 SV=1
17	AFDB:A0A024QZV9	0.033	0.059	3.296E-2	834	0.029	0.066	A0A024QZV9.pdb.gz
18	AFDB:A0A0B4LGK0	0.031	0.045	4.312E-2	1198	0.032	0.051	A0A0B4LGK0.pdb.gz	A0A0B4LGK0_DROME Stac-like, isoform V OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
19	AFDB:A0A0B4LF79	0.030	0.050	4.931E-2	1000	0.032	0.062	A0A0B4LF79.pdb.gz	A0A0B4LF79_DROME Stac-like, isoform Q OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
20	AFDB:Q63767	0.035	0.060	6.451E-2	968	0.035	0.070	Q63767.pdb.gz	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R151	0.0	3445	1909	0.876	0.881	ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus OX=10090 GN=Znfx1 PE=1 SV=3
2	Q9P2E3	0.0	3988	1918	1.000	1.000	ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=ZNFX1 PE=1 SV=2
3	O74465	2.44e-107	371	999	0.157	0.302	HRR1_SCHPO Helicase required for RNAi-mediated heterochromatin assembly 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrr1 PE=1 SV=2
4	Q582S3	4.57e-44	179	1414	0.059	0.081	Q582S3_TRYB2 CCHC-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.90 PE=4 SV=1
5	Q9FJR0	6.87e-32	139	1254	0.055	0.084	RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana OX=3702 GN=UPF1 PE=1 SV=2
6	Q582F1	1.70e-31	136	842	0.047	0.108	Q582F1_TRYB2 Regulator of nonsense transcripts 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.50 PE=3 SV=1
7	F1RCY6	2.25e-31	137	1100	0.057	0.100	RENT1_DANRE Regulator of nonsense transcripts 1 OS=Danio rerio OX=7955 GN=upf1 PE=2 SV=1
8	Q9EPU0	3.03e-31	136	1124	0.055	0.094	RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus OX=10090 GN=Upf1 PE=1 SV=2
9	A0A024R7L5	3.17e-31	136	1118	0.055	0.095	A0A024R7L5_HUMAN UPF1 OS=Homo sapiens OX=9606 GN=UPF1 PE=2 SV=1
10	Q92900	3.62e-31	136	1129	0.055	0.094	RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2
11	Q9VYS3	2.22e-29	130	1180	0.051	0.083	RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster OX=7227 GN=Upf1 PE=1 SV=2
12	Q8L5Y4	4.29e-29	130	1509	0.061	0.078	Q8L5Y4_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EMB2765 PE=1 SV=1
13	O76512	1.57e-28	127	1069	0.048	0.086	RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans OX=6239 GN=smg-2 PE=1 SV=1
14	Q9U1Q7	2.82e-28	127	1467	0.051	0.067	Q9U1Q7_CAEEL Intron-binding protein aquarius OS=Caenorhabditis elegans OX=6239 GN=emb-4 PE=1 SV=4
15	Q09820	5.48e-28	125	925	0.050	0.104	RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=upf1 PE=3 SV=2
16	Q8MQK8	6.94e-28	125	1006	0.049	0.093	Q8MQK8_DROME GM03621p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG14730 PE=2 SV=1
17	Q9VGG9	7.57e-28	125	1483	0.049	0.063	Q9VGG9_DROME RE35509p OS=Drosophila melanogaster OX=7227 GN=CG14729 PE=1 SV=4
18	Q7KSN8	7.64e-28	125	1486	0.049	0.063	Q7KSN8_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG14729 PE=1 SV=2
19	Q8MSA2	8.52e-28	125	872	0.049	0.108	Q8MSA2_DROME LP02069p OS=Drosophila melanogaster OX=7227 GN=CG14730 PE=2 SV=1
20	P30771	4.25e-27	122	971	0.048	0.096	RENT1_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	3.2e+02	13.2	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	2.1e-30	118.0	AAA domain
3	PF13087 AAA_12	5.6e-36	135.5	AAA domain
4	PF13245 AAA_19	4.5e-07	41.6	AAA domain
5	PF13401 AAA_22	3.9	19.2	AAA domain
6	PF13604 AAA_30	0.00011	33.5	AAA domain
7	PF07728 AAA_5	5.2e+02	12.0	AAA domain (dynein-related subfamily)
8	PF09848 DUF2075	1.6	19.5	Schlafen group 3, DNA/RNA helicase domain
9	PF20173 DUF6539	6.9e-18	75.3	Family of unknown function (DUF6539)
10	PF02190 LON_substr_bdg	2.5e+02	12.9	ATP-dependent protease La (LON) substrate-binding domain
11	PF02562 PhoH	52	14.7	PhoH-like protein
12	PF08372 PRT_C	4.2e+02	12.1	Plant phosphoribosyltransferase C-terminal
13	PF04851 ResIII	5.9	18.4	Type III restriction enzyme, res subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379412

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369424	0.907	Histone-binding protein RBBP7
2	9606.ENSP00000232165	0.905	Ubiquitin-protein ligase E3A
3	9606.ENSP00000362649	0.905	Histone deacetylase 1
4	9606.ENSP00000369131	0.905	Paired amphipathic helix protein Sin3b
5	9606.ENSP00000378402	0.905	Paired amphipathic helix protein Sin3a
6	9606.ENSP00000430432	0.905	Histone deacetylase 2
7	9606.ENSP00000362592	0.902	Histone-binding protein RBBP4
8	9606.ENSP00000481842	0.902	Histone deacetylase complex subunit SAP18
9	9606.ENSP00000296504	0.900	Histone deacetylase complex subunit SAP30
10	9606.ENSP00000368856	0.819	Transcriptional repressor NF-X1
11	9606.ENSP00000263549	0.791	poly(ADP-ribose) polymerase family member 12
12	9606.ENSP00000257570	0.730	2'-5'-oligoadenylate synthase-like protein
13	9606.ENSP00000308591	0.721	Galactose-3-O-sulfotransferase 3
14	9606.ENSP00000397563	0.686	Poly(A) RNA polymerase GLD2
15	9606.ENSP00000259030	0.683	Receptor-transporting protein 4
16	9606.ENSP00000220592	0.676	Protein argonaute-2
17	9606.ENSP00000333657	0.675	Interferon-induced GTP-binding protein Mx2
18	9606.ENSP00000437256	0.666	Endoribonuclease Dicer
19	9606.ENSP00000215794	0.656	Ubl carboxyl-terminal hydrolase 18
20	9606.ENSP00000360860	0.637	Interferon-induced protein with tetratricopeptide repeats 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.762	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0009615	0.977	response to virus
GO:0140546	0.976	defense response to symbiont
GO:0051607	0.964	defense response to virus
GO:0050789	0.836	regulation of biological process
GO:0048519	0.769	negative regulation of biological process
GO:0048518	0.479	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0016020	0.996	membrane
GO:0031974	0.927	membrane-enclosed lumen
GO:0070013	0.912	intracellular organelle lumen
GO:0005634	0.888	nucleus
GO:0005829	0.869	cytosol
GO:0099080	0.857	supramolecular complex
GO:0036464	0.819	cytoplasmic ribonucleoprotein granule
GO:0005739	0.815	mitochondrion
GO:0031981	0.788	nuclear lumen
GO:0010494	0.745	cytoplasmic stress granule
GO:0005654	0.716	nucleoplasm
GO:0031090	0.704	organelle membrane
GO:0031967	0.564	organelle envelope
GO:0098588	0.480	bounding membrane of organelle
GO:0031966	0.365	mitochondrial membrane
GO:0032991	0.323	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]