StarFunc result for job id Q9P2E9

User Input

>input (1410 residues)
MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKVEKK
KKEKTVEKKGKTKKKEEKPNGKIPDHDPAPNVTVLLREPVRAPAVAVAPTPVQPPIIVAP
VATVPAMPQEKLASSPKDKKKKEKKVAKVEPAVSSVVNSIQVLTSKAAILETAPKEVPMV
VVPPVGAKGNTPATGTTQGKKAEGTQNQSKKAEGAPNQGRKAEGTPNQGKKTEGTPNQGK
KAEGTPNQGKKAEGTPNQGKKAEGAQNQGKKVDTTPNQGKKVEGAPTQGRKAEGAQNQAK
KVEGAQNQGKKAEGAQNQGKKGEGAQNQGKKAEGAQNQGKKAEGAQNQGKKAEGAQNQGK
KAEGAQNQGKKAEGAQNQGKKAEGAQNQGKKVEGAQNQGKKAEGAQNQGKKAEGAQNQGK
KAEGAQNQGKKAEGAQNQGKKAEGAQNQGKKAEGAQNQGKKAEGAQNQGKKVEGAQNQGK
KAEGAQNQGKKAEGAQNQGKKAEGAQNQGQKGEGAQNQGKKTEGAQGKKAERSPNQGKKG
EGAPIQGKKADSVANQGTKVEGITNQGKKAEGSPSEGKKAEGSPNQGKKADAAANQGKKT
ESASVQGRNTDVAQSPEAPKQEAPAKKKSGSKKKGEPGPPDADGPLYLPYKTLVSTVGSM
VFNEGEAQRLIEILSEKAGIIQDTWHKATQKGDPVAILKRQLEEKEKLLATEQEDAAVAK
SKLRELNKEMAAEKAKAAAGEAKVKKQLVAREQEITAVQARMQASYREHVKEVQQLQGKI
RTLQEQLENGPNTQLARLQQENSILRDALNQATSQVESKQNAELAKLRQELSKVSKELVE
KSEAVRQDEQQRKALEAKAAAFEKQVLQLQASHRESEEALQKRLDEVSRELCHTQSSHAS
LRADAEKAQEQQQQMAELHSKLQSSEAEVRSKCEELSGLHGQLQEARAENSQLTERIRSI
EALLEAGQARDAQDVQASQAEADQQQTRLKELESQVSGLEKEAIELREAVEQQKVKNNDL
REKNWKAMEALATAEQACKEKLLSLTQAKEESEKQLCLIEAQTMEALLALLPELSVLAQQ
NYTEWLQDLKEKGPTLLKHPPAPAEPSSDLASKLREAEETQSTLQAECDQYRSILAETEG
MLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLEEIVEKLKGELESSDQVREHTSH
LEAELEKHMAAASAECQNYAKEVAGLRQLLLESQSQLDAAKSEAQKQSDELALVRQQLSE
MKSHVEDGDIAGAPASSPEAPPAEQDPVQLKTQLEWTEAILEDEQTQRQKLTAEFEEAQT
SACRLQEELEKLRTAGPLESSETEEASQLKERLEKEKKLTSDLGRAATRLQELLKTTQEQ
LAREKDTVKKLQEQLEKAEDGSSSKEGTSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2E9	1.000	1.000	0.000	1410	1.000	1.000	Q9P2E9.pdb.gz	RRBP1_HUMAN Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5
2	AFDB:Q28298	0.252	0.238	4.164E-99	1534	0.844	0.776	Q28298.pdb.gz	RRBP1_CANLF Ribosome-binding protein 1 OS=Canis lupus familiaris OX=9615 GN=RRBP1 PE=2 SV=1
3	AFDB:F1M853	0.251	0.245	4.430E-87	1453	0.806	0.783	F1M853.pdb.gz	F1M853_RAT Ribosome binding protein 1 OS=Rattus norvegicus OX=10116 GN=Rrbp1 PE=1 SV=3
4	AFDB:Q99PL5	0.364	0.327	4.672E-86	1605	0.809	0.711	Q99PL5.pdb.gz	RRBP1_MOUSE Ribosome-binding protein 1 OS=Mus musculus OX=10090 GN=Rrbp1 PE=1 SV=2
5	AFDB:F1P0K1	0.162	0.224	1.335E-40	997	0.461	0.652	F1P0K1.pdb.gz
6	AFDB:Q86UP2	0.080	0.082	1.430E-8	1357	0.138	0.144	Q86UP2.pdb.gz	KTN1_HUMAN Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1
7	AFDB:Q61595	0.075	0.078	5.796E-7	1327	0.152	0.162	Q61595.pdb.gz	KTN1_MOUSE Kinectin OS=Mus musculus OX=10090 GN=Ktn1 PE=1 SV=1
8	AFDB:A0A024R370	0.090	0.113	1.548E-2	1093	0.104	0.134	A0A024R370.pdb.gz
9	AFDB:Q9UPV0	0.106	0.102	2.503E-2	1460	0.114	0.110	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
10	AFDB:Q08378	0.097	0.092	2.626E-2	1498	0.123	0.116	Q08378.pdb.gz	GOGA3_HUMAN Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3 PE=1 SV=2
11	PDB:2wleC	0.044	0.115	3.369	211	0.010	0.066	2wleC.pdb.gz	Structural and Kinetic Characterizations of the Polysialic Acid O-Acetyltransferase Oatwy from Neisseria Meningitidis.
12	PDB:7ungA3	0.076	0.211	3.369	333	0.026	0.108	7ungA3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
13	PDB:7rroA3	0.104	0.325	3.892	334	0.026	0.108	7rroA3.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
14	PDB:7rroA1	0.105	0.283	4.949	396	0.027	0.096	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:6o8bB	0.060	0.101	9.246	657	0.018	0.040	6o8bB.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
16	PDB:7ungC1	0.090	0.261	9.246	336	0.019	0.080	7ungC1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
17	PDB:8dcxB	0.036	0.178	9.246	236	0.015	0.089	8dcxB.pdb.gz
18	PDB:7ungB0	0.089	0.524	9.701	193	0.022	0.161	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WU26	0.0	682	346	0.245	1.000	A0A087WU26_HUMAN Ribosome binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=1
2	F1M853	0.0	2053	1453	0.826	0.802	F1M853_RAT Ribosome binding protein 1 OS=Rattus norvegicus OX=10116 GN=Rrbp1 PE=1 SV=3
3	F8W7S5	0.0	1477	751	0.533	1.000	F8W7S5_HUMAN Ribosome binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=1
4	Q07718	0.0	731	725	0.289	0.563	Q07718_CHICK ES/130 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
5	Q28298	0.0	1821	1534	0.739	0.679	RRBP1_CANLF Ribosome-binding protein 1 OS=Canis lupus familiaris OX=9615 GN=RRBP1 PE=2 SV=1
6	Q99PL5	0.0	1814	1605	0.711	0.625	RRBP1_MOUSE Ribosome-binding protein 1 OS=Mus musculus OX=10090 GN=Rrbp1 PE=1 SV=2
7	Q9P2E9	0.0	2762	1410	1.000	1.000	RRBP1_HUMAN Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5
8	Q86UP2	5.72e-44	177	1357	0.097	0.101	KTN1_HUMAN Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1
9	Q61595	1.89e-42	172	1327	0.098	0.104	KTN1_MOUSE Kinectin OS=Mus musculus OX=10090 GN=Ktn1 PE=1 SV=1
10	Q4AAD6	4.50e-20	99.8	1092	0.035	0.046	Q4AAD6_MESHJ Adhesin OS=Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) OX=262719 GN=MHJ_0194 PE=1 SV=1
11	Q6MWX9	5.52e-20	99.8	3157	0.074	0.033	Q6MWX9_MYCTU PPE family protein PPE55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=PPE55 PE=3 SV=1
12	F4JW79	1.11e-18	95.5	1493	0.045	0.043	RDM3_ARATH Protein RNA-directed DNA methylation 3 OS=Arabidopsis thaliana OX=3702 GN=RDM3 PE=1 SV=1
13	O96124	2.34e-17	91.3	2441	0.118	0.068	O96124_PLAF7 Erythrocyte membrane protein 3 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0201900 PE=4 SV=1
14	Q6MX48	2.19e-14	80.9	963	0.072	0.105	Q6MX48_MYCTU PPE family protein PPE6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=PPE6 PE=3 SV=1
15	Q6MWY2	2.96e-13	77.8	2523	0.046	0.026	PPE54_MYCTU Uncharacterized PPE family protein PPE54 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=PPE54 PE=3 SV=1
16	Q4GYE7	8.06e-08	59.7	1638	0.023	0.020	Q4GYE7_TRYB2 PDZ domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4310 PE=4 SV=1
17	H8ESG1	2.75e-06	54.7	1494	0.056	0.053	H8ESG1_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
18	G5EBN5	3.01e-06	54.7	1492	0.056	0.053	G5EBN5_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
19	G8B4T8	8.30e-06	53.1	1429	0.051	0.050	G8B4T8_CANPC Hyphally-regulated cell wall protein N-terminal domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=HYR31 PE=4 SV=1
20	Q383H0	2.87e-05	51.2	1439	0.047	0.046	Q383H0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2880 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16962 ABC_export	6.7e+02	10.1	Putative ABC exporter
2	PF01469 Pentapeptide_2	4.3e-13	60.2	Pentapeptide repeats (8 copies)
3	PF05104 Rib_recp_KP_reg	1.1e-32	125.5	Ribosome receptor lysine/proline rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000017098

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000020509	0.806	ZW10 interacting kinetochore protein
2	9555.ENSPANP00000003853	0.731	Carnosine synthase 1
3	9555.ENSPANP00000010538	0.715	Histidine ammonia-lyase
4	9555.ENSPANP00000017181	0.707	Synaptojanin 2 binding protein
5	9555.ENSPANP00000013000	0.703	Translocation associated membrane protein 2
6	9555.ENSPANP00000014400	0.691	De-etiolated homolog 1 (Arabidopsis)
7	9555.ENSPANP00000013599	0.675	Belongs to the protein disulfide isomerase family.
8	9555.ENSPANP00000015407	0.643	M-phase specific PLK1 interacting protein
9	9555.ENSPANP00000014214	0.610	La ribonucleoprotein domain family, member 6
10	9555.ENSPANP00000017611	0.608	Myosin, heavy chain 7, cardiac muscle, beta
11	9555.ENSPANP00000016364	0.598	Protein disulfide-isomerase
12	9555.ENSPANP00000012367	0.578	Eukaryotic elongation factor-2 kinase
13	9555.ENSPANP00000012695	0.546	Collagen, type VI, alpha 2
14	9555.ENSPANP00000012700	0.538	Collagen, type VI, alpha 1
15	9555.ENSPANP00000013956	0.534	DEAH-box helicase 16
16	9555.ENSPANP00000005680	0.502	EPH receptor A3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0003674	1.000	molecular_function
GO:1901363	0.979	heterocyclic compound binding
GO:0097159	0.979	organic cyclic compound binding
GO:0003676	0.943	nucleic acid binding
GO:0003723	0.931	RNA binding
GO:0038023	0.918	signaling receptor activity
GO:0005515	0.897	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0032501	0.958	multicellular organismal process
GO:0071704	0.958	organic substance metabolic process
GO:0006807	0.948	nitrogen compound metabolic process
GO:0044238	0.935	primary metabolic process
GO:0032502	0.903	developmental process
GO:0044237	0.861	cellular metabolic process
GO:0043170	0.843	macromolecule metabolic process
GO:0034641	0.832	cellular nitrogen compound metabolic process
GO:0043603	0.827	amide metabolic process
GO:0043604	0.807	amide biosynthetic process
GO:1901564	0.787	organonitrogen compound metabolic process
GO:0006518	0.742	peptide metabolic process
GO:0010467	0.735	gene expression
GO:1901576	0.719	organic substance biosynthetic process
GO:0001503	0.693	ossification
GO:0043043	0.644	peptide biosynthetic process
GO:0034645	0.615	cellular macromolecule biosynthetic process
GO:0019538	0.575	protein metabolic process
GO:0030154	0.558	cell differentiation
GO:0006412	0.557	translation
GO:0065007	0.507	biological regulation
GO:0050896	0.473	response to stimulus
GO:0050789	0.471	regulation of biological process
GO:0050794	0.454	regulation of cellular process
GO:0048856	0.318	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.998	membrane
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0005840	0.303	ribosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]