StarFunc result for job id Q9P2F6

User Input

>input (1191 residues)
MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSCTKKKMKTLAERRRSAPSLILDKALQKRP
TTRDSPSASVDTCTFLSSLVCSNRTLLIDGRAELKRGLQRQERHLFLFNDLFVVAKIKYN
NNFKIKNKIKLTDMWTASCVDEVGEGNTNAMKSFVLGWPTVNFVATFSSPEQKDKWLSLL
QRYINLEKEKDYPKSIPLKIFAKDIGNCAYSKTITVMNSDTANEVINMSLPMLGITGSER
DYQLWVNSGKEEAPYPLIGHEYPYGIKMSHLRDSALLTPGSKDSTTPFNLQEPFLMEQLP
REMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPSSPTSPMPG
QLFGISLPNICENDNLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEV
HLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVMDQGNDEEKINTVQRLLDQLPRA
NVVLLRYLFGVLHNIEQHSSSNQMTAFNLAVCVAPSILWPPASSSPELENEFTKKVSLLI
QFLIENCLRIFGEEITSLFREVSVRCDTRENASDISCFQLNDSSYDSLENELNEDVDAPC
SDLVKKLGQGSRSMDSVLTLSDYDLDQPEVEGLLTLSDFDLAHSKDEDVQMKRPLESKPV
NILVYTKIPLRDHARAPSAMCTPSYLSTAAANAAKSLRRHRRCSEPSIDYLDSKLSYLRE
FYQKKLRKSSCDAILSQKDEDYLKQNQPLQEEGKTCFKQSLVTGTDVSKKNATTQNTKKK
SLSGSEGNHVKLFPKSKPVAISVASYSPMSSQDHSKNQPFDVNTSGYSPPHTADALKGPR
THRRCSEPNIEDQNRKLTYLRGIYSKKQHKTSCEAGLLHGEEDYLKRHKSLQMEGQKLIN
QSLVMGIEVGKSSATNQNTEKVLPPRLNLCPRTSYSSLSSPGTSPSGSSVSSQDSAFSQI
SEHSVFTPTETSSPIDCTFQAQRKREDLSPDFSNASHVSGMPGPSSGQACSRPAYTKKDT
MEWHSQMHSVTLHPSTWLRNGVASLKNWSLKKKAKAARPEEEKIASPKGPLEPPPHASGV
PEANSLQEEQKDLPLRAAEGLSPVQSAQRCSSSPFQDSERHCSSPFSLVESRLKLCMKSH
EEIEPGSQSSSGSLPWERASASSWTLEDATSPDSGPTVVCDIEDRYLTKDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6REY9	0.357	0.359	0.000	1182	0.794	0.800	Q6REY9.pdb.gz	RHG20_RAT Rho GTPase-activating protein 20 OS=Rattus norvegicus OX=10116 GN=Arhgap20 PE=1 SV=2
2	AFDB:Q9P2F6	0.999	0.999	0.000	1191	1.000	1.000	Q9P2F6.pdb.gz	RHG20_HUMAN Rho GTPase-activating protein 20 OS=Homo sapiens OX=9606 GN=ARHGAP20 PE=1 SV=2
3	AFDB:Q8N103	0.175	0.280	1.147E-22	731	0.139	0.227	Q8N103.pdb.gz	TAGAP_HUMAN T-cell activation Rho GTPase-activating protein OS=Homo sapiens OX=9606 GN=TAGAP PE=1 SV=1
4	AFDB:X2JEI9	0.158	0.088	2.366E-17	2206	0.160	0.087	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
5	AFDB:A7KAX9	0.161	0.094	3.062E-15	2087	0.171	0.098	A7KAX9.pdb.gz	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
6	AFDB:D4A9G6	0.168	0.154	9.406E-15	1310	0.167	0.152	D4A9G6.pdb.gz	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
7	AFDB:F1MAK3	0.162	0.097	2.739E-14	2101	0.177	0.100	F1MAK3.pdb.gz	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
8	AFDB:Q9VIS1	0.163	0.109	5.201E-14	1843	0.163	0.105	Q9VIS1.pdb.gz	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
9	AFDB:A6X8Z5	0.157	0.132	1.514E-13	1425	0.137	0.114	A6X8Z5.pdb.gz	RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus OX=10090 GN=Arhgap31 PE=1 SV=1
10	AFDB:Q2M1Z3	0.162	0.135	4.410E-13	1444	0.134	0.111	Q2M1Z3.pdb.gz	RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2
11	PDB:6r3vA	0.151	0.859	6.935E-13	198	0.050	0.298	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
12	PDB:3cxlA	0.148	0.426	9.986E-11	402	0.035	0.104	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
13	PDB:5c2kA	0.156	0.467	2.465E-9	382	0.038	0.118	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
14	PDB:1xa6A	0.149	0.431	6.115E-9	399	0.037	0.110	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
15	PDB:5jcpA	0.138	0.415	2.880E-8	361	0.037	0.122	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
16	PDB:7rx9A	0.073	0.193	1.268E-4	432	0.031	0.086	7rx9A.pdb.gz
17	PDB:4mt6A	0.078	0.226	1.570E-4	389	0.016	0.049	4mt6A.pdb.gz
18	PDB:6hhgA	0.079	0.215	1.843E-4	386	0.023	0.070	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
19	PDB:3ljuX	0.076	0.230	2.051E-4	373	0.010	0.032	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
20	PDB:5yqrA	0.081	0.321	2.051E-4	268	0.014	0.063	5yqrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6REY9	0.0	1862	1182	0.794	0.800	RHG20_RAT Rho GTPase-activating protein 20 OS=Rattus norvegicus OX=10116 GN=Arhgap20 PE=1 SV=2
2	Q9P2F6	0.0	2464	1191	1.000	1.000	RHG20_HUMAN Rho GTPase-activating protein 20 OS=Homo sapiens OX=9606 GN=ARHGAP20 PE=1 SV=2
3	Q8N103	5.75e-49	189	731	0.085	0.138	TAGAP_HUMAN T-cell activation Rho GTPase-activating protein OS=Homo sapiens OX=9606 GN=TAGAP PE=1 SV=1
4	B2RWW0	1.02e-37	154	714	0.084	0.140	TAGAP_MOUSE T-cell activation Rho GTPase-activating protein OS=Mus musculus OX=10090 GN=Tagap PE=2 SV=2
5	Q9XW53	1.62e-32	139	908	0.112	0.146	Q9XW53_CAEEL Rho GTPase-activating protein 20 OS=Caenorhabditis elegans OX=6239 GN=rga-2 PE=1 SV=1
6	A0A8I6A7T6	2.81e-21	100	410	0.047	0.137	A0A8I6A7T6_RAT Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1
7	Q8IQM3	5.16e-21	101	604	0.057	0.113	Q8IQM3_DROME Rho GTPase activating protein at 71E, isoform B OS=Drosophila melanogaster OX=7227 GN=RhoGAP71E PE=1 SV=1
8	M9MRW2	5.22e-21	101	598	0.057	0.114	M9MRW2_DROME Rho GTPase activating protein at 71E, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP71E PE=1 SV=1
9	M9PFR0	5.24e-21	97.4	301	0.057	0.226	M9PFR0_DROME Rho GTPase activating protein at 71E, isoform F OS=Drosophila melanogaster OX=7227 GN=RhoGAP71E PE=1 SV=1
10	D4A6C5	5.80e-21	99.8	439	0.047	0.128	D4A6C5_RAT Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1
11	Q5FWK3	5.85e-21	99.8	439	0.047	0.128	RHG01_MOUSE Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Arhgap1 PE=1 SV=1
12	A0A0G2JYR5	6.16e-21	100	512	0.047	0.109	A0A0G2JYR5_RAT Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1
13	Q9VUR5	6.47e-21	100	606	0.057	0.112	Q9VUR5_DROME LD04071p OS=Drosophila melanogaster OX=7227 GN=RhoGAP71E PE=1 SV=2
14	E7EQN5	8.21e-21	101	925	0.064	0.082	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
15	E9PCM6	8.60e-21	101	768	0.064	0.099	E9PCM6_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
16	Q9VUR6	9.38e-21	101	896	0.057	0.076	Q9VUR6_DROME Rho GTPase activating protein at 71E, isoform C OS=Drosophila melanogaster OX=7227 GN=RhoGAP71E PE=1 SV=2
17	P98171	1.06e-20	101	946	0.064	0.080	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
18	B7Z058	1.28e-20	100	906	0.057	0.075	B7Z058_DROME Rho GTPase activating protein at 71E, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP71E PE=1 SV=1
19	Q07960	1.46e-20	98.6	439	0.048	0.130	RHG01_HUMAN Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1
20	M9PFL1	1.58e-20	98.6	454	0.057	0.150	M9PFL1_DROME Rho GTPase activating protein at 71E, isoform G OS=Drosophila melanogaster OX=7227 GN=RhoGAP71E PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16453 IQ_SEC7_PH	57	15.0	PH domain
2	PF17114 Nod1	4.4e+02	12.4	Gef2-related medial cortical node protein Nod1
3	PF19057 PH_19	1.9e+02	13.1	PH domain
4	PF00788 RA	3.2e-09	48.6	Ras association (RalGDS/AF-6) domain
5	PF00620 RhoGAP	9.9e-36	134.3	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260283

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362372	0.950	Bromodomain and WD repeat-containing protein 3
2	9606.ENSP00000400175	0.855	Transforming protein RhoA
3	9606.ENSP00000300128	0.747	Transmembrane protein 194A
4	9606.ENSP00000348168	0.714	Transcription initiation factor IIE subunit beta
5	9606.ENSP00000273352	0.708	Adhesion G-protein coupled receptor G7
6	9606.ENSP00000264400	0.705	Ras-GEF domain-containing family member 1B
7	9606.ENSP00000451263	0.682	Mitogen-activated protein kinase kinase kinase 9
8	9606.ENSP00000325376	0.672	Heterogeneous nuclear ribonucleoprotein M
9	9606.ENSP00000331640	0.652	Transmembrane protein 186
10	9606.ENSP00000417185	0.617	Von Willebrand factor A domain-containing protein 1
11	9606.ENSP00000384103	0.605	V-set and transmembrane domain-containing protein 2A
12	9606.ENSP00000331662	0.601	Armadillo repeat-containing X-linked protein 2
13	9606.ENSP00000439625	0.584	Pleckstrin homology domain-containing family G member 5
14	9606.ENSP00000401145	0.583	Growth arrest-specific protein 2
15	9606.ENSP00000354053	0.562	Glycosyltransferase 8 domain containing 2
16	9606.ENSP00000225474	0.554	Granulocyte colony-stimulating factor
17	9606.ENSP00000259746	0.541	CSC1-like protein 2
18	9606.ENSP00000280098	0.539	Speckle-type POZ protein-like
19	9606.ENSP00000377001	0.539	Speckle-type POZ protein
20	9606.ENSP00000340668	0.534	Transmembrane protein 248

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0005515	0.999	protein binding
GO:0019899	0.726	enzyme binding
GO:0051020	0.308	GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:1902531	0.986	regulation of intracellular signal transduction
GO:0051056	0.981	regulation of small GTPase mediated signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.934	organelle
GO:0043227	0.923	membrane-bounded organelle
GO:0043231	0.795	intracellular membrane-bounded organelle
GO:0005634	0.315	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]