StarFunc result for job id Q9P2F8

User Input

>input (1722 residues)
MSDPRQSQEEKHKLGRASSKFKDPPRIMQSDDYFARKFKAINGNMGPTTSLNASNSNETG
GGGPANGTPAVPKMGVRARVSEWPPKKDCSKELTCKALWESRSQTSYESITSVLQNGQSD
QSEGQQDEQLDLDFVEAKYTIGDIFVHSPQRGLHPIRQRSNSDVTISDIDAEDVLDQNAV
NPNTGAALHREYGSTSSIDRQGLSGENFFAMLRGYRVENYDHKAMVPFGFPEFFRCDPAI
SPSLHAAAQISRGEFVRISGLDYVDSALLMGRDRDKPFKRRLKSESVETSLFRKLRTVKS
EHETFKFTSELEESRLERGIRPWNCQRCFAHYDVQSILFNINEAMATRANVGKRKNITTG
ASAASQTQMPTGQTGNCESPLGSKEDLNSKENLDADEGDGKSNDLVLSCPYFRNETGGEG
DRRIALSRANSSSFSSGESCSFESSLSSHCTNAGVSVLEVPRENQPIHREKVKRYIIEHI
DLGAYYYRKFFYGKEHQNYFGIDENLGPVAVSIRREKVEDAKEKEGSQFNYRVAFRTSEL
TTLRGAILEDAIPSTARHGTARGLPLKEVLEYVIPELSIQCLRQASNSPKVSEQLLKLDE
QGLSFQHKIGILYCKAGQSTEEEMYNNETAGPAFEEFLDLLGQRVRLKGFSKYRAQLDNK
TDSTGTHSLYTTYKDYELMFHVSTLLPYMPNNRQQLLRKRHIGNDIVTIVFQEPGALPFT
PKSIRSHFQHVFVIVKVHNPCTENVCYSVGVSRSKDVPPFGPPIPKGVTFPKSAVFRDFL
LAKVINAENAAHKSEKFRAMATRTRQEYLKDLAENFVTTATVDTSVKFSFITLGAKKKEK
VKPRKDAHLFSIGAIMWHVIARDFGQSADIECLLGISNEFIMLIEKDSKNVVFNCSCRDV
IGWTSGLVSIKVFYERGECVLLSSVDNCAEDIREIVQRLVIVTRGCETVEMTLRRNGLGQ
LGFHVNFEGIVADVEPFGFAWKAGLRQGSRLVEICKVAVATLTHEQMIDLLRTSVTVKVV
IIQPHDDGSPRRGCSELCRIPMVEYKLDSEGTPCEYKTPFRRNTTWHRVPTPALQPLSRA
SPIPGTPDRLPCQQLLQQAQAAIPRSTSFDRKLPDGTRSSPSNQSSSSDPGPGGSGPWRP
QVGYDGCQSPLLLEHQGSGPLECDGAREREDTMEASRHPETKWHGPPSKVLGSYKERALQ
KDGSCKDSPNKLSHIGDKSCSSHSSSNTLSSNTSSNSDDKHFGSGDLMDPELLGLTYIKG
ASTDSGIDTAPCMPATILGPVHLAGSRSLIHSRAEQWADAADVSGPDDEPAKLYSVHGYA
STISAGSAAEGSMGDLSEISSHSSGSHHSGSPSAHCSKSSGSLDSSKVYIVSHSSGQQVP
GSMSKPYHRQGAVNKYVIGWKKSEGSPPPEEPEVTECPGMYSEMDVMSTATQHQTVVGDA
VAETQHVLSKEDFLKLMLPDSPLVEEGRRKFSFYGNLSPRRSLYRTLSDESICSNRRGSS
FGSSRSSVLDQALPNDILFSTTPPYHSTLPPRAHPAPSMGSLRNEFWFSDGSLSDKSKCA
DPGLMPLPDTATGLDWTHLVDAARAFEGLDSDEELGLLCHHTSYLDQRVASFCTLTDMQH
GQDLEGAQELPLCVDPGSGKEFMDTTGERSPSPLTGKVNQLELILRQLQTDLRKEKQDKA
VLQAEVQHLRQDNMRLQEESQTATAQLRKFTEWFFTTIDKKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8RNK4	0.478	0.479	0.000	1718	0.425	0.426	A0A2R8RNK4.pdb.gz
2	AFDB:O35412	0.487	0.462	0.000	1822	0.529	0.500	O35412.pdb.gz	SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sipa1l1 PE=1 SV=1
3	AFDB:O43166	0.524	0.502	0.000	1804	0.531	0.507	O43166.pdb.gz	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
4	AFDB:O60292	0.436	0.423	0.000	1781	0.473	0.457	O60292.pdb.gz	SI1L3_HUMAN Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens OX=9606 GN=SIPA1L3 PE=1 SV=3
5	AFDB:Q8C0T5	0.481	0.466	0.000	1782	0.528	0.510	Q8C0T5.pdb.gz	SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus OX=10090 GN=Sipa1l1 PE=1 SV=2
6	AFDB:Q9P2F8	1.000	1.000	0.000	1722	1.000	1.000	Q9P2F8.pdb.gz	SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens OX=9606 GN=SIPA1L2 PE=1 SV=2
7	PDB:7dl2B	0.110	0.169	2.195E-11	1042	0.040	0.066	7dl2B.pdb.gz
8	PDB:7dl2A	0.104	0.148	2.874E-11	1127	0.041	0.062	7dl2A.pdb.gz
9	AFDB:Q17353	0.050	0.061	3.191E-5	1379	0.102	0.127	Q17353.pdb.gz	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1
10	AFDB:Q8WYB5	0.045	0.040	2.752E-4	2073	0.131	0.109	Q8WYB5.pdb.gz	KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens OX=9606 GN=KAT6B PE=1 SV=3
11	PDB:6r9tA	0.054	0.043	3.338E-4	2185	0.010	0.008	6r9tA.pdb.gz
12	AFDB:Q9V9S7	0.041	0.039	4.469E-4	1866	0.133	0.123	Q9V9S7.pdb.gz	SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2
13	AFDB:A0A0B4JDC9	0.048	0.046	5.253E-4	1844	0.102	0.095	A0A0B4JDC9.pdb.gz	A0A0B4JDC9_DROME RIM-binding protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
14	PDB:7qqmA	0.042	0.168	1.283E-3	413	0.012	0.051	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:7qqnC	0.046	0.173	1.974E-3	414	0.010	0.043	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:7p73A	0.042	0.168	2.199E-3	420	0.012	0.050	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:7pc3A	0.042	0.170	2.199E-3	405	0.013	0.057	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:7p70A	0.042	0.170	3.038E-3	407	0.008	0.032	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
19	PDB:7pcbA	0.040	0.160	3.977E-3	415	0.013	0.055	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:2l4tA	0.042	0.499	5.799E-3	124	0.013	0.177	2l4tA.pdb.gz	Promiscuous binding at the crossroads of numerous cancer pathways: insight from the binding of glutaminase interacting protein with glutaminase L.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PSX8	0.0	634	1040	0.200	0.332	E9PSX8_RAT Signal-induced proliferation-associated 1 OS=Rattus norvegicus OX=10116 GN=Sipa1 PE=1 SV=1
2	F5GYF8	0.0	1126	1257	0.393	0.539	F5GYF8_HUMAN Signal induced proliferation associated 1 like 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=1
3	G3X9J0	0.0	1289	1776	0.469	0.455	SI1L3_MOUSE Signal-induced proliferation-associated 1-like protein 3 OS=Mus musculus OX=10090 GN=Sipa1l3 PE=1 SV=1
4	G5EBY5	0.0	591	995	0.178	0.309	G5EBY5_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sipa-1 PE=1 SV=1
5	O35412	0.0	1524	1822	0.535	0.506	SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sipa1l1 PE=1 SV=1
6	O43166	0.0	1553	1804	0.533	0.508	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
7	O60292	0.0	1294	1781	0.477	0.462	SI1L3_HUMAN Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens OX=9606 GN=SIPA1L3 PE=1 SV=3
8	P46062	0.0	626	1037	0.200	0.332	SIPA1_MOUSE Signal-induced proliferation-associated protein 1 OS=Mus musculus OX=10090 GN=Sipa1 PE=1 SV=2
9	Q6I7S1	0.0	632	1040	0.200	0.331	Q6I7S1_RAT GTPase-activating protein OS=Rattus norvegicus OX=10116 GN=Sipa1 PE=2 SV=1
10	Q8C0T5	0.0	1547	1782	0.538	0.520	SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus OX=10090 GN=Sipa1l1 PE=1 SV=2
11	Q96FS4	0.0	640	1042	0.186	0.307	SIPA1_HUMAN Signal-induced proliferation-associated protein 1 OS=Homo sapiens OX=9606 GN=SIPA1 PE=1 SV=1
12	Q9P2F8	0.0	3586	1722	1.000	1.000	SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens OX=9606 GN=SIPA1L2 PE=1 SV=2
13	Q9VM02	1.42e-70	258	850	0.081	0.165	Q9VM02_DROME Rap GTPase activating protein 1, isoform E OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=1
14	Q59DZ5	2.72e-70	257	876	0.081	0.160	Q59DZ5_DROME Rap GTPase activating protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=1
15	Q9VM00	3.29e-70	258	933	0.081	0.150	Q9VM00_DROME Rap GTPase activating protein 1, isoform D OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=2
16	O44090	4.12e-70	256	850	0.081	0.164	O44090_DROME GTPase activating protein for Rap1 OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=2 SV=1
17	A8DYW8	6.85e-70	257	959	0.081	0.146	A8DYW8_DROME Rap GTPase activating protein 1, isoform H OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=2
18	Q86RS9	5.12e-67	244	741	0.077	0.178	Q86RS9_CAEEL Rap1GAP (Fragment) OS=Caenorhabditis elegans OX=6239 PE=1 SV=1
19	H2L055	8.69e-67	245	811	0.077	0.163	H2L055_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F53A10.2 PE=1 SV=1
20	Q5SVL6	9.21e-66	240	712	0.081	0.195	RPGP2_MOUSE Rap1 GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Rap1gap2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07716 bZIP_2	9.8e+02	11.3	Basic region leucine zipper
2	PF00595 PDZ	0.074	24.7	PDZ domain
3	PF17820 PDZ_6	6.3	18.1	PDZ domain
4	PF02145 Rap_GAP	2.2e-61	218.1	Rap/ran-GAP
5	PF11881 SPAR_C	3.4e-69	244.8	C-terminal domain of SPAR protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355589

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000250559	0.833	Ras-related protein Rap-1b
2	9606.ENSP00000358723	0.827	Ras-related protein Rap-1A
3	9606.ENSP00000385957	0.714	Kelch repeat and BTB domain containing 12
4	9606.ENSP00000327468	0.704	Kelch domain-containing protein 8B
5	9606.ENSP00000391788	0.675	Interactor of HORMAD1 protein 1
6	9606.ENSP00000330289	0.672	Trafficking protein particle complex subunit 6B
7	9606.ENSP00000454945	0.670	Transmembrane protein 204
8	9606.ENSP00000261517	0.636	Vacuolar protein sorting-associated protein 13C
9	9606.ENSP00000345972	0.635	FYN-binding protein 2
10	9606.ENSP00000219481	0.629	Peroxisomal 2,4-dienoyl-CoA reductase
11	9606.ENSP00000244496	0.626	Ribosomal RNA processing protein 36 homolog
12	9606.ENSP00000262305	0.625	Rab11 family-interacting protein 3
13	9606.ENSP00000263881	0.618	Mitogen-activated protein kinase kinase kinase kinase 3
14	9606.ENSP00000359240	0.616	Leucine zipper putative tumor suppressor 2
15	9606.ENSP00000346483	0.601	DDRGK domain-containing protein 1
16	9606.ENSP00000341805	0.600	PHD finger protein 10
17	9606.ENSP00000410811	0.592	Fidgetin-like protein 1
18	9606.ENSP00000314036	0.583	1-acyl-sn-glycerol-3-phosphate acyltransferase delta
19	9606.ENSP00000455215	0.575	Adhesion G-protein coupled receptor G1
20	9606.ENSP00000261435	0.566	NEDD4-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.961	regulation of biological process
GO:0050794	0.839	regulation of cellular process
GO:0050896	0.445	response to stimulus
GO:0032502	0.390	developmental process
GO:0048856	0.382	anatomical structure development
GO:0071840	0.375	cellular component organization or biogenesis
GO:0016043	0.323	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0071944	0.959	cell periphery
GO:0016020	0.958	membrane
GO:0005886	0.950	plasma membrane
GO:0005737	0.921	cytoplasm
GO:0043227	0.886	membrane-bounded organelle
GO:0005856	0.812	cytoskeleton
GO:0043231	0.729	intracellular membrane-bounded organelle
GO:0015629	0.414	actin cytoskeleton
GO:0012505	0.398	endomembrane system
GO:0005634	0.310	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]