StarFunc result for job id Q9P2G1

User Input

>input (1089 residues)
MGNTTTKFRKALINGDENLACQIYENNPQLKESLDPNTSYGEPYQHNTPLHYAARHGMNK
ILGTFLGRDGNPNKRNVHNETSMHLLCMGPQIMISEGALHPRLARPTEDDFRRADCLQMI
LKWKGAKLDQGEYERAAIDAVDNKKNTPLHYAAASGMKACVELLVKHGGDLFAENENKDT
PCDCAEKQHHKDLALNLESQMVFSRDPEAEEIEAEYAALDKREPYEGLRPQDLRRLKDML
IVETADMLQAPLFTAEALLRAHDWDREKLLEAWMSNPENCCQRSGVQMPTPPPSGYNAWD
TLPSPRTPRTTRSSVTSPDEISLSPGDLDTSLCDICMCSISVFEDPVDMPCGHDFCRGCW
ESFLNLKIQEGEAHNIFCPAYDCFQLVPVDIIESVVSKEMDKRYLQFDIKAFVENNPAIK
WCPTPGCDRAVRLTKQGSNTSGSDTLSFPLLRAPAVDCGKGHLFCWECLGEAHEPCDCQT
WKNWLQKITEMKPEELVGVSEAYEDAANCLWLLTNSKPCANCKSPIQKNEGCNHMQCAKC
KYDFCWICLEEWKKHSSSTGGYYRCTRYEVIQHVEEQSKEMTVEAEKKHKRFQELDRFMH
YYTRFKNHEHSYQLEQRLLKTAKEKMEQLSRALKETEGGCPDTTFIEDAVHVLLKTRRIL
KCSYPYGFFLEPKSTKKEIFELMQTDLEMVTEDLAQKVNRPYLRTPRHKIIKAACLVQQK
RQEFLASVARGVAPADSPEAPRRSFAGGTWDWEYLGFASPEEYAEFQYRRRHRQRRRGDV
HSLLSNPPDPDEPSESTLDIPEGGSSSRRPGTSVVSSASMSVLHSSSLRDYTPASRSENQ
DSLQALSSLDEDDPNILLAIQLSLQESGLALDEETRDFLSNEASLGAIGTSLPSRLDSVP
RNTDSPRAALSSSELLELGDSLMRLGAENDPFSTDTLSSHPLSEARSDFCPSSSDPDSAG
QDPNINDNLLGNIMAWFHDMNPQSIALIPPATTEISADSQLPCIKDGSEGVKDVELVLPE
DSMFEDASVSEGRGTQIEENPLEENILAGEAASQAGDSGNEAANRGDGSDVSSQTPQTSS
DWLEQVHLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2G1	1.000	1.000	0.000	1089	1.000	1.000	Q9P2G1.pdb.gz	AKIB1_HUMAN Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKIB1 PE=1 SV=3
2	PDB:7od1A	0.217	0.454	2.100E-21	430	0.118	0.298	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
3	PDB:7b5lH	0.240	0.529	7.009E-19	423	0.119	0.307	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
4	PDB:5tteB	0.240	0.489	1.679E-18	442	0.124	0.305	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
5	PDB:4kblA	0.233	0.536	3.318E-16	395	0.117	0.322	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
6	PDB:7oniH	0.207	0.467	1.485E-14	380	0.088	0.253	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
7	AFDB:A2A690	0.115	0.070	5.483E-6	1994	0.128	0.070	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
8	PDB:8cs9A	0.133	0.179	5.842E-6	796	0.048	0.065	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
9	PDB:7b5sH	0.157	0.687	1.077E-5	216	0.056	0.282	7b5sH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
10	PDB:2dvwA	0.111	0.385	7.363E-5	229	0.033	0.157	2dvwA.pdb.gz
11	AFDB:Q9C0D5	0.109	0.068	1.070E-4	1861	0.116	0.068	Q9C0D5.pdb.gz	TANC1_HUMAN Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3
12	PDB:1wg0A	0.116	0.383	1.140E-4	243	0.038	0.169	1wg0A.pdb.gz
13	PDB:6v9hC	0.128	0.465	1.357E-4	270	0.031	0.126	6v9hC.pdb.gz
14	AFDB:P0C6S7	0.139	0.122	3.052E-4	1260	0.109	0.094	P0C6S7.pdb.gz	ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Anks1b PE=1 SV=1
15	AFDB:Q0VGY8	0.110	0.069	6.140E-4	1856	0.129	0.075	Q0VGY8.pdb.gz	TANC1_MOUSE Protein TANC1 OS=Mus musculus OX=10090 GN=Tanc1 PE=1 SV=2
16	AFDB:Q5DU14	0.069	0.044	2.208E-2	1919	0.149	0.084	Q5DU14.pdb.gz	MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus OX=10090 GN=Myo16 PE=1 SV=2
17	AFDB:Q8K285	0.070	0.084	2.306E-2	873	0.090	0.112	Q8K285.pdb.gz	FCHO1_MOUSE F-BAR domain only protein 1 OS=Mus musculus OX=10090 GN=Fcho1 PE=1 SV=2
18	AFDB:F1Q4L8	0.053	0.059	8.554E-2	908	0.080	0.096	F1Q4L8.pdb.gz	F1Q4L8_DANRE CCR4-NOT transcription complex subunit 3 OS=Danio rerio OX=7955 GN=cnot3 PE=3 SV=2
19	AFDB:Q8ND23	0.056	0.049	9.335E-2	1372	0.086	0.069	Q8ND23.pdb.gz	CARL3_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 3 OS=Homo sapiens OX=9606 GN=CARMIL3 PE=2 SV=2
20	AFDB:Q6PR54	0.089	0.048	1.267E-1	2419	0.135	0.061	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P2G1	0.0	2271	1089	1.000	1.000	AKIB1_HUMAN Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKIB1 PE=1 SV=3
2	Q6T486	1.46e-70	247	520	0.143	0.300	RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum OX=44689 GN=rbrA PE=3 SV=1
3	Q9P3U4	5.94e-65	230	504	0.137	0.296	HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbl4 PE=3 SV=1
4	Q8W468	1.74e-56	208	567	0.138	0.265	ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana OX=3702 GN=ARI8 PE=2 SV=1
5	Q94981	3.08e-52	194	503	0.129	0.278	ARI1_DROME E3 ubiquitin-protein ligase ariadne-1 OS=Drosophila melanogaster OX=7227 GN=ari-1 PE=1 SV=2
6	O95376	6.89e-51	189	493	0.126	0.278	ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens OX=9606 GN=ARIH2 PE=1 SV=1
7	Q6IBL8	6.89e-51	189	493	0.126	0.278	Q6IBL8_HUMAN RBR-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 GN=ARIH2 PE=2 SV=1
8	Q9Z1K6	8.47e-51	189	492	0.127	0.280	ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus OX=10090 GN=Arih2 PE=1 SV=1
9	Q9Z1K5	1.39e-48	184	555	0.133	0.261	ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus OX=10090 GN=Arih1 PE=1 SV=3
10	Q9Y4X5	1.41e-48	184	557	0.133	0.260	ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens OX=9606 GN=ARIH1 PE=1 SV=2
11	O01965	7.99e-48	181	494	0.126	0.277	ARI11_CAEEL E3 ubiquitin-protein ligase ari-1.1 OS=Caenorhabditis elegans OX=6239 GN=ari-1.1 PE=1 SV=3
12	P36113	2.61e-39	156	551	0.123	0.243	HEL1_YEAST E3 ubiquitin-protein ligase HEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HEL1 PE=1 SV=1
13	Q8IWT3	1.64e-29	130	2517	0.111	0.048	CUL9_HUMAN Cullin-9 OS=Homo sapiens OX=9606 GN=CUL9 PE=1 SV=2
14	E9PEZ1	1.75e-29	130	2489	0.111	0.049	E9PEZ1_HUMAN Cullin 9 OS=Homo sapiens OX=9606 GN=CUL9 PE=1 SV=1
15	Q84RQ9	1.41e-26	117	496	0.090	0.198	ARI12_ARATH Probable E3 ubiquitin-protein ligase ARI12 OS=Arabidopsis thaliana OX=3702 GN=ARI12 PE=2 SV=2
16	Q54DM8	5.60e-20	99.0	1214	0.056	0.050	Q54DM8_DICDI RING zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=cnrK PE=4 SV=1
17	A2A7Q9	2.46e-16	86.7	732	0.056	0.083	RN19B_MOUSE E3 ubiquitin-protein ligase RNF19B OS=Mus musculus OX=10090 GN=Rnf19b PE=1 SV=2
18	Q6ZMZ0	3.97e-16	85.9	732	0.056	0.083	RN19B_HUMAN E3 ubiquitin-protein ligase RNF19B OS=Homo sapiens OX=9606 GN=RNF19B PE=1 SV=2
19	Q9UBS8	1.66e-15	82.8	474	0.054	0.124	RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens OX=9606 GN=RNF14 PE=1 SV=1
20	Q9FFP1	2.05e-15	82.8	506	0.113	0.243	ARI14_ARATH Probable E3 ubiquitin-protein ligase ARI14 OS=Arabidopsis thaliana OX=3702 GN=ARI14 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.2e-06	39.8	Ankyrin repeat
2	PF12796 Ank_2	2.8e-06	39.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.0024	29.1	Ankyrin repeat
4	PF13637 Ank_4	0.00035	32.3	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.0016	30.0	Ankyrin repeats (many copies)
6	PF19422 Ariadne	2.1e-10	52.4	Ariadne domain
7	PF01485 IBR	5.9e-18	76.1	IBR domain, a half RING-finger domain
8	PF00097 zf-C3HC4	24	16.2	Zinc finger, C3HC4 type (RING finger)
9	PF13923 zf-C3HC4_2	4.5	18.5	Zinc finger, C3HC4 type (RING finger)
10	PF15227 zf-C3HC4_4	7.3	18.1	zinc finger of C3HC4-type, RING
11	PF13639 zf-RING_2	23	16.8	Ring finger domain
12	PF13445 zf-RING_UBOX	0.1	24.0	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265742

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000374552	0.805	E3 ubiquitin-protein ligase RNF216
2	9606.ENSP00000282251	0.782	CWF19-like protein 2
3	9606.ENSP00000428756	0.592	Double-stranded RNA-binding protein Staufen homolog 2
4	9606.ENSP00000370891	0.580	Serine/threonine kinase 35
5	9606.ENSP00000215812	0.575	SEC14-like protein 3
6	9606.ENSP00000405987	0.564	Leucine rich repeats and death domain containing 1
7	9606.ENSP00000217169	0.551	Baculoviral IAP repeat-containing protein 7
8	9606.ENSP00000297792	0.513	Lysine-specific histone demethylase 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004842	0.851	ubiquitin-protein transferase activity
GO:0061630	0.695	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.978	organic substance metabolic process
GO:0009987	0.976	cellular process
GO:0044238	0.975	primary metabolic process
GO:0050789	0.943	regulation of biological process
GO:0006807	0.926	nitrogen compound metabolic process
GO:0043170	0.878	macromolecule metabolic process
GO:1901564	0.792	organonitrogen compound metabolic process
GO:0032446	0.774	protein modification by small protein conjugation
GO:0016567	0.753	protein ubiquitination
GO:0050794	0.740	regulation of cellular process
GO:1901565	0.652	organonitrogen compound catabolic process
GO:0044237	0.507	cellular metabolic process
GO:0051603	0.457	proteolysis involved in protein catabolic process
GO:0044260	0.325	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.990	cytosol
GO:0043229	0.985	intracellular organelle
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005634	0.880	nucleus
GO:0070013	0.840	intracellular organelle lumen
GO:0031981	0.829	nuclear lumen
GO:0016020	0.804	membrane
GO:0000151	0.395	ubiquitin ligase complex
GO:0031461	0.384	cullin-RING ubiquitin ligase complex
GO:0005654	0.369	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.851	Transferases.

[back to server]