StarFunc result for job id Q9P2H0

User Input

>input (1117 residues)
MLAGRPGTRSAVGELGTESSDNLDRAPLGPRESGGHHRPGSYLDMKIHLEKNLEEERQIL
LQQQKICRNRARKYFVESNRRKKAFEEKRKEQEEKEHQIREQILQQRKQKFEEVTEKFQR
AHVPLSQRRKAVSRKPVPPLEEALKQIQESNLKSEVNLPFSRRPTINWRAIDSALPSALS
KNDHKHQKQLLSKINCEKEMNENMRATLATSKNVFQLKLEETQKLLEDQHLSNLQKFGDE
VNQITNSETLSSIDSLEATEHEEIYLTLNKEHSTSIQRNTISLKPANMQSTNLSCFDEDK
LAFSKTQHINNWLTNLDASNTQNVTAFSDILSKSNVLPSWEYFNSKEQNPSPLNGTVERA
TNTANNSVPFVSSPPMFVLDKKCEKTSETSTMRTTDSTSGAFKRERPLVTESPTFKFSKS
QSTSDSLTQEVATFPDQEKYSELNQENGTTSIPTSCVPVATPLVLPSNIQSARPSAKNSI
HIKEIDAVQCSDKLDELKDGKEEEIKYFNCNKEELPLFSDSFQDAYIPHNPDSKDEKQKL
AETSSLSNVTSNYDFVGQHKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFK
FGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHS
QQFHIQSGAGSNIISVSTCAVNSADTKKSREDSISENVTTLGGSGADHMPLNCFIPSGYN
FAKHAWPASKKEESKIPVHDDSKTKQGKPQRGRAKIIRKPGSAKVQSGFICTNRKGAVIQ
PQSASKVNIFTQAQGKLIIPCPPPQSTSNIRSGKNIQVSQCQPVTPENPQNIITHNSFNS
KHVLPTEHSLNQWNQESSSPLSNACSDLVTVIPSLPSYCSSECQTFAKINHSNGTQAVAR
QDATLYCTQRSPVCEESYPSVTLRTAEEESVPLWKRGPNVLHQNKRATGSTVMRRKRIAE
TKRRNILEQKRQNPGSVGQKYSEQINNFGQSVLLSSSEPKQTTRGTSYIEEVSDSTSEFL
MAENLVKASVPEDEILTVLNSKQIQKSNLPLNKTQQFNICTLSAEEQKILESLNDLSERL
HYIQESICKNPSIKNTLQIIPLLEKREDRTSSCRDKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2H0	1.000	1.000	0.000	1117	1.000	1.000	Q9P2H0.pdb.gz	CE126_HUMAN Centrosomal protein of 126 kDa OS=Homo sapiens OX=9606 GN=CEP126 PE=1 SV=4
2	AFDB:F1QWN1	0.088	0.091	1.353E-2	1063	0.100	0.105	F1QWN1.pdb.gz	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2
3	AFDB:Q57UR3	0.060	0.069	2.662E-2	934	0.116	0.139	Q57UR3.pdb.gz	Q57UR3_TRYB2 C2H2-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.110 PE=3 SV=1
4	AFDB:Q57Y65	0.065	0.050	2.849E-2	1617	0.144	0.100	Q57Y65.pdb.gz	Q57Y65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.280 PE=4 SV=1
5	AFDB:Q9HBR0	0.036	0.036	3.996E-2	1119	0.090	0.090	Q9HBR0.pdb.gz	S38AA_HUMAN Solute carrier family 38 member 10 OS=Homo sapiens OX=9606 GN=SLC38A10 PE=1 SV=2
6	AFDB:Q70IV5	0.048	0.036	4.275E-2	1561	0.111	0.079	Q70IV5.pdb.gz	SYNEM_MOUSE Synemin OS=Mus musculus OX=10090 GN=Synm PE=1 SV=2
7	AFDB:Q1LY77	0.044	0.033	4.575E-2	1844	0.130	0.079	Q1LY77.pdb.gz	SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio OX=7955 GN=setd1ba PE=1 SV=2
8	AFDB:Q54WH7	0.044	0.061	4.895E-2	759	0.105	0.154	Q54WH7.pdb.gz	Y5961_DICDI Putative uncharacterized protein DDB_G0279653 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279653 PE=4 SV=1
9	AFDB:Q13625	0.076	0.076	5.997E-2	1128	0.106	0.105	Q13625.pdb.gz	ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2
10	AFDB:Q7TPM1	0.046	0.037	5.997E-2	1486	0.128	0.096	Q7TPM1.pdb.gz	PRC2B_MOUSE Protein PRRC2B OS=Mus musculus OX=10090 GN=Prrc2b PE=1 SV=1
11	PDB:3h87C	0.029	0.258	3.322	72	0.008	0.125	3h87C.pdb.gz	The crystal structure of the Rv0301-Rv0300 VapBC-3 toxin-antitoxin complex from M. tuberculosis reveals a Mg(2+) ion in the active site and a putative RNA-binding site.
12	PDB:7d4iRJ	0.054	0.078	4.354	738	0.017	0.026	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
13	PDB:5x3tA	0.029	0.256	4.659	70	0.006	0.100	5x3tA.pdb.gz
14	PDB:6iczM	0.027	0.145	4.985	130	0.013	0.108	6iczM.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
15	PDB:6eu0V	0.041	0.139	5.335	273	0.021	0.084	6eu0V.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
16	PDB:6zqaUB	0.052	0.107	5.335	504	0.018	0.040	6zqaUB.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
17	PDB:7r5jW0	0.032	0.045	6.535	735	0.021	0.033	7r5jW0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	PDB:1rm1C	0.027	0.221	7.482	116	0.005	0.052	1rm1C.pdb.gz	High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
19	PDB:4v6wCD	0.026	0.094	8.567	290	0.010	0.038	4v6wCD.pdb.gz	Structures of the human and Drosophila 80S ribosome.
20	PDB:7jtkF	0.056	0.173	8.567	287	0.032	0.125	7jtkF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P2H0	0.0	2303	1117	1.000	1.000	CE126_HUMAN Centrosomal protein of 126 kDa OS=Homo sapiens OX=9606 GN=CEP126 PE=1 SV=4
2	Q586D8	0.79	36.6	1522	0.023	0.017	Q586D8_TRYB2 Present in the outer mitochondrial membrane proteome 22 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.135 PE=4 SV=1
3	Q7ZUI0	1.6	34.7	297	0.019	0.071	Q7ZUI0_DANRE 60S ribosomal protein L5 OS=Danio rerio OX=7955 GN=zgc:77176 PE=1 SV=1
4	Q7Z5P9	1.9	35.4	8384	0.025	0.003	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3
5	Q9BZ95	3.9	34.3	1437	0.030	0.024	NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3 PE=1 SV=1
6	O59825	4.4	33.5	325	0.016	0.055	TDG_SCHPO G/U mismatch-specific uracil DNA glycosylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=thp1 PE=3 SV=1
7	Q8IYA8	4.7	33.5	594	0.027	0.051	IHO1_HUMAN Interactor of HORMAD1 protein 1 OS=Homo sapiens OX=9606 GN=IHO1 PE=1 SV=2
8	Q7XQR9	5.8	33.5	705	0.022	0.035	MRE11_ORYSJ Double-strand break repair protein MRE11 OS=Oryza sativa subsp. japonica OX=39947 GN=MRE11 PE=1 SV=2
9	C5H5I1	8.0	33.1	1864	0.034	0.020	C5H5I1_DANRE Plexin B2 OS=Danio rerio OX=7955 GN=plxnB2 PE=1 SV=1
10	F1QBC0	8.0	33.1	1864	0.034	0.020	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15352 K1377	0	1768.1	Susceptibility to monomelic amyotrophy

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263468

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414390	0.761	Uncharacterized protein C11orf70
2	9606.ENSP00000309836	0.708	Coiled-coil domain-containing protein 13
3	9606.ENSP00000383808	0.700	Coiled-coil domain containing 18
4	9606.ENSP00000378167	0.687	Microtubule-binding protein required for ciliogenesis . May function in ciliogenesis by mediating the transport of proteins like BBS4 to the cilium, but also through the organization of the centriolar satellites . Plays a role in retina morphogenesis and/or homeostasis (By similarity).
5	9606.ENSP00000317144	0.670	Progesterone-induced-blocking factor 1
6	9606.ENSP00000355250	0.668	Protein moonraker
7	9606.ENSP00000358582	0.653	AP-4 complex subunit beta-1
8	9606.ENSP00000292314	0.643	Coiled-coil domain containing 12
9	9606.ENSP00000263370	0.584	Inositol-trisphosphate 3-kinase C
10	9606.ENSP00000410818	0.578	MAD2L1-binding protein
11	9606.ENSP00000389014	0.544	Protein JBTS17
12	9606.ENSP00000335255	0.526	Angiopoietin-related protein 5
13	9606.ENSP00000255759	0.524	LisH domain-containing protein FOPNL
14	9606.ENSP00000420180	0.518	Coiled-coil domain-containing protein 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0016043	0.982	cellular component organization
GO:0022402	0.977	cell cycle process
GO:0006996	0.961	organelle organization
GO:0000278	0.955	mitotic cell cycle
GO:0022607	0.927	cellular component assembly
GO:0000226	0.926	microtubule cytoskeleton organization
GO:0060271	0.919	cilium assembly
GO:1903047	0.878	mitotic cell cycle process
GO:0031122	0.869	cytoplasmic microtubule organization
GO:1902850	0.812	microtubule cytoskeleton organization involved in mitosis
GO:0007052	0.776	mitotic spindle organization
GO:0065007	0.400	biological regulation
GO:0050794	0.315	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	1.000	centrosome
GO:0030496	0.998	midbody
GO:0097546	0.998	ciliary base
GO:0005737	0.942	cytoplasm
GO:0005829	0.908	cytosol
GO:0043231	0.687	intracellular membrane-bounded organelle
GO:0005634	0.452	nucleus
GO:0070013	0.339	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]