StarFunc result for job id Q9P2H5

User Input

>input (1018 residues)
MDKILEAVVTSSYPVSVKQGLVRRVLEAARQPLEREQCLALLALGARLYVGGAEELPRRV
GCQLLHVAGRHHPDVFAEFFSARRVLRLLQGGAGPPGPRALACVQLGLQLLPEGPAADEV
FALLRREVLRTVCERPGPAACAQVARLLARHPRCVPDGPHRLLFCQQLVRCLGRFRCPAE
GEEGAVEFLEQAQQVSGLLAQLWRAQPAAILPCLKELFAVISCAEEEPPSSALASVVQHL
PLELMDGVVRNLSNDDSVTDSQMLTAISRMIDWVSWPLGKNIDKWIIALLKGLAAVKKFS
ILIEVSLTKIEKVFSKLLYPIVRGAALSVLKYMLLTFQHSHEAFHLLLPHIPPMVASLVK
EDSNSGTSCLEQLAELVHCMVFRFPGFPDLYEPVMEAIKDLHVPNEDRIKQLLGQDAWTS
QKSELAGFYPRLMAKSDTGKIGLINLGNTCYVNSILQALFMASDFRHCVLRLTENNSQPL
MTKLQWLFGFLEHSQRPAISPENFLSASWTPWFSPGTQQDCSEYLKYLLDRLHEEEKTGT
RICQKLKQSSSPSPPEEPPAPSSTSVEKMFGGKIVTRICCLCCLNVSSREEAFTDLSLAF
PPPERCRRRRLGSVMRPTEDITARELPPPTSAQGPGRVGPRRQRKHCITEDTPPTSLYIE
GLDSKEAGGQSSQEERIEREEEGKEERTEKEEVGEEEESTRGEGEREKEEEVEEEEEKVE
KETEKEAEQEKEEDSLGAGTHPDAAIPSGERTCGSEGSRSVLDLVNYFLSPEKLTAENRY
YCESCASLQDAEKVVELSQGPCYLILTLLRFSFDLRTMRRRKILDDVSIPLLLRLPLAGG
RGQAYDLCSVVVHSGVSSESGHYYCYAREGAARPAASLGTADRPEPENQWYLFNDTRVSF
SSFESVSNVTSFFPKDTAYVLFYRQRPREGPEAELGSSRVRTEPTLHKDLMEAISKDNIL
YLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2H5	1.000	1.000	0.000	1018	1.000	1.000	Q9P2H5.pdb.gz	UBP35_HUMAN Ubiquitin carboxyl-terminal hydrolase 35 OS=Homo sapiens OX=9606 GN=USP35 PE=1 SV=3
2	AFDB:Q8NB14	0.543	0.532	6.459E-79	1042	0.450	0.440	Q8NB14.pdb.gz	UBP38_HUMAN Ubiquitin carboxyl-terminal hydrolase 38 OS=Homo sapiens OX=9606 GN=USP38 PE=1 SV=2
3	AFDB:Q7JQI1	0.456	0.529	6.064E-38	852	0.227	0.271	Q7JQI1.pdb.gz	Q7JQI1_DROME Deubiquitinating apoptotic inhibitor, isoform A OS=Drosophila melanogaster OX=7227 GN=DUBAI PE=2 SV=1
4	AFDB:F1M625	0.288	0.765	7.607E-21	366	0.112	0.311	F1M625.pdb.gz	UBP46_RAT Ubiquitin carboxyl-terminal hydrolase 46 OS=Rattus norvegicus OX=10116 GN=Usp46 PE=1 SV=2
5	PDB:5cvnB	0.274	0.829	3.069E-20	321	0.106	0.336	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
6	AFDB:P34547	0.284	0.652	7.198E-20	426	0.100	0.239	P34547.pdb.gz	UBP46_CAEEL Ubiquitin carboxyl-terminal hydrolase 46 OS=Caenorhabditis elegans OX=6239 GN=usp-46 PE=1 SV=3
7	AFDB:O75317	0.286	0.752	8.556E-20	370	0.110	0.303	O75317.pdb.gz	UBP12_HUMAN Ubiquitin carboxyl-terminal hydrolase 12 OS=Homo sapiens OX=9606 GN=USP12 PE=1 SV=2
8	PDB:7yxxA	0.302	0.180	1.075E-19	1754	0.155	0.090	7yxxA.pdb.gz
9	AFDB:Q70EL2	0.286	0.354	8.096E-19	814	0.124	0.155	Q70EL2.pdb.gz	UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45 OS=Homo sapiens OX=9606 GN=USP45 PE=1 SV=3
10	AFDB:Q8BY87	0.299	0.225	6.729E-18	1376	0.116	0.086	Q8BY87.pdb.gz	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
11	AFDB:Q76LT8	0.306	0.301	7.660E-18	1036	0.101	0.099	Q76LT8.pdb.gz	UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus OX=10116 GN=Usp48 PE=1 SV=1
12	PDB:5k16B	0.258	0.738	1.482E-17	328	0.103	0.320	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
13	AFDB:Q9LEW0	0.276	0.494	7.903E-17	557	0.108	0.197	Q9LEW0.pdb.gz	UBP22_ARATH Ubiquitin C-terminal hydrolase 22 OS=Arabidopsis thaliana OX=3702 GN=UBP22 PE=1 SV=1
14	PDB:8a9kD	0.244	0.834	3.434E-15	285	0.092	0.330	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
15	PDB:3mhsA	0.258	0.553	5.290E-15	455	0.087	0.196	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
16	PDB:7ay1D	0.276	0.787	1.830E-13	341	0.095	0.284	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
17	PDB:5k1bA	0.229	0.809	3.654E-13	264	0.102	0.394	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
18	PDB:7w3ax	0.253	0.497	4.344E-13	494	0.083	0.170	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
19	PDB:4fjcE	0.238	0.526	4.292E-12	434	0.086	0.203	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
20	PDB:7qo48	0.256	0.662	1.569E-11	372	0.079	0.215	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RRA6	0.0	1132	604	0.544	0.917	A2RRA6_HUMAN USP35 protein OS=Homo sapiens OX=9606 GN=USP35 PE=1 SV=1
2	Q8NB14	0.0	597	1042	0.303	0.296	UBP38_HUMAN Ubiquitin carboxyl-terminal hydrolase 38 OS=Homo sapiens OX=9606 GN=USP38 PE=1 SV=2
3	Q9P2H5	0.0	2078	1018	1.000	1.000	UBP35_HUMAN Ubiquitin carboxyl-terminal hydrolase 35 OS=Homo sapiens OX=9606 GN=USP35 PE=1 SV=3
4	Q7JQI1	4.16e-45	178	852	0.125	0.149	Q7JQI1_DROME Deubiquitinating apoptotic inhibitor, isoform A OS=Drosophila melanogaster OX=7227 GN=DUBAI PE=2 SV=1
5	A0A0R4IB93	5.34e-19	95.5	1047	0.050	0.049	UBP48_DANRE Ubiquitin carboxyl-terminal hydrolase 48 OS=Danio rerio OX=7955 GN=usp48 PE=3 SV=1
6	F1M625	1.75e-17	87.8	366	0.059	0.164	UBP46_RAT Ubiquitin carboxyl-terminal hydrolase 46 OS=Rattus norvegicus OX=10116 GN=Usp46 PE=1 SV=2
7	P62068	2.06e-17	87.4	366	0.059	0.164	UBP46_HUMAN Ubiquitin carboxyl-terminal hydrolase 46 OS=Homo sapiens OX=9606 GN=USP46 PE=1 SV=1
8	P62069	2.06e-17	87.4	366	0.059	0.164	UBP46_MOUSE Ubiquitin carboxyl-terminal hydrolase 46 OS=Mus musculus OX=10090 GN=Usp46 PE=1 SV=1
9	Q86UV5	3.80e-17	89.4	1035	0.046	0.045	UBP48_HUMAN Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens OX=9606 GN=USP48 PE=1 SV=1
10	Q6P8X6	4.11e-16	84.0	390	0.061	0.159	UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1
11	Q76LT8	6.55e-16	85.5	1036	0.045	0.044	UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus OX=10116 GN=Usp48 PE=1 SV=1
12	Q9D9M2	1.24e-14	79.3	370	0.059	0.162	UBP12_MOUSE Ubiquitin carboxyl-terminal hydrolase 12 OS=Mus musculus OX=10090 GN=Usp12 PE=2 SV=2
13	O74442	3.37e-14	78.6	457	0.056	0.125	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
14	H0YLB7	1.00e-13	77.0	431	0.058	0.137	H0YLB7_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
15	O75317	1.52e-13	75.9	370	0.058	0.159	UBP12_HUMAN Ubiquitin carboxyl-terminal hydrolase 12 OS=Homo sapiens OX=9606 GN=USP12 PE=1 SV=2
16	E9Q9U0	1.57e-13	76.6	468	0.049	0.107	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
17	E7F4C0	1.90e-13	77.4	1104	0.054	0.050	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
18	D4A4F6	2.13e-13	76.3	476	0.072	0.153	D4A4F6_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=4
19	A0A8I6A0C2	2.18e-13	76.3	482	0.064	0.135	A0A8I6A0C2_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=1
20	Q6JHV3	2.72e-13	75.9	498	0.074	0.151	Q6JHV3_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00443 UCH	6.4e-39	145.7	Ubiquitin carboxyl-terminal hydrolase
2	PF13423 UCH_1	2e-15	68.8	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000431876

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257548	0.723	Ubiquitin carboxyl-terminal hydrolase 30
2	9606.ENSP00000307491	0.631	WD repeat-containing protein 48
3	9606.ENSP00000285199	0.618	Ubiquitin carboxyl-terminal hydrolase 43
4	9606.ENSP00000471735	0.553	Probable protease (By similarity). Acts as a sensor of N(6)- methyladenosine methylation on DNA (m6A): recognizes and binds m6A DNA, leading to its degradation .
5	9606.ENSP00000285420	0.540	[Isoform 1]: Deubiquitinating enzyme that may play a role in the ubiquitin-dependent regulation of protein synthesis, downstream of mTORC1 . May associate with the protein synthesis initiation complex and modify its ubiquitination to repress translation . May also repress DNA synthesis and modify different cellular targets thereby regulating cell growth and proliferation . May also play a role in proteasome assembly and function
6	9606.ENSP00000401721	0.537	PAN2-PAN3 deadenylation complex catalytic subunit PAN2
7	9606.ENSP00000263966	0.529	Ubiquitin carboxyl-terminal hydrolase 13
8	9606.ENSP00000339389	0.528	OTU domain-containing protein 6A
9	9606.ENSP00000339340	0.523	BTB/POZ domain-containing protein KCTD21
10	9606.ENSP00000312981	0.517	U4/U6.U5 tri-snRNP-associated protein 2
11	9606.ENSP00000345216	0.517	Inactive ubiquitin carboxyl-terminal hydrolase 54
12	9606.ENSP00000423390	0.517	Ubiquitin carboxyl-terminal hydrolase 26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0005488	0.991	binding
GO:0005515	0.983	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019538	0.995	protein metabolic process
GO:0016579	0.992	protein deubiquitination
GO:0050789	0.493	regulation of biological process
GO:0050794	0.399	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0031981	0.997	nuclear lumen
GO:0005654	0.988	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]