StarFunc result for job id Q9P2J2

User Input

>input (1179 residues)
MVWCLGLAVLSLVISQGADGRGKPEVVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRF
GFLLPIFIQFGLYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPED
DFANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLGQG
QGQVQVQNGTLRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNA
SQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLATQPDDAGCYT
CVPSNGLLHPPSASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKD
GKALQLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAF
IERPKEEYFQEVGRELLIPCSAQGDPPPVVSWTKVGRGLQGQAQVDSNSSLILRPLTKEA
HGHWECSASNAVARVATSTNVYVLGTSPHVVTNVSVVALPKGANVSWEPGFDGGYLQRFS
VWYTPLAKRPDRMHHDWVSLAVPVGAAHLLVPGLQPHTQYQFSVLAQNKLGSGPFSEIVL
SAPEGLPTTPAAPGLPPTEIPPPLSPPRGLVAVRTPRGVLLHWDPPELVPKRLDGYVLEG
RQGSQGWEVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSDPSNTANVSTSGLEV
YPSRTQLPGLLPQPVLAGVVGGVCFLGVAVLVSILAGCLLNRRRAARRRRKRLRQDPPLI
FSPTGKSAAPSALGSGSPDSVAKLKLQGSPVPSLRQSLLWGDPAGTPSPHPDPPSSRGPL
PLEPICRGPDGRFVMGPTVAAPQERSGREQAEPRTPAQRLARSFDCSSSSPSGAPQPLCI
EDISPVAPPPAAPPSPLPGPGPLLQYLSLPFFREMNVDGDWPPLEEPSPAAPPDYMDTRR
CPTSSFLRSPETPPVSPRESLPGAVVGAGATAEPPYTALADWTLRERLLPGLLPAAPRGS
LTSQSSGRGSASFLRPPSTAPSAGGSYLSPAPGDTSSWASGPERWPRREHVVTVSKRRNT
SVDENYEWDSEFPGDMELLETLHLGLASSRLRPEAEPELGVKTPEEGCLLNTAHVTGPEA
RCAALREEFLAFRRRRDATRARLPAYRQPVPHPEQATLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05BQ1	0.433	0.433	0.000	1179	0.877	0.877	Q05BQ1.pdb.gz	TUTLA_MOUSE Protein turtle homolog A OS=Mus musculus OX=10090 GN=Igsf9 PE=1 SV=2
2	AFDB:Q9P2J2	1.000	1.000	0.000	1179	1.000	1.000	Q9P2J2.pdb.gz	TUTLA_HUMAN Protein turtle homolog A OS=Homo sapiens OX=9606 GN=IGSF9 PE=1 SV=2
3	AFDB:D3ZB51	0.416	0.375	5.926E-100	1328	0.405	0.360	D3ZB51.pdb.gz	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
4	AFDB:Q967D7	0.329	0.263	4.335E-78	1531	0.276	0.212	Q967D7.pdb.gz	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
5	AFDB:Q9U4G1	0.180	0.266	5.198E-55	719	0.173	0.284	Q9U4G1.pdb.gz	BDL_DROME Protein borderless OS=Drosophila melanogaster OX=7227 GN=bdl PE=1 SV=1
6	AFDB:Q9VPZ7	0.207	0.187	1.085E-49	1342	0.197	0.173	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
7	AFDB:Q96MS0	0.186	0.166	1.138E-49	1386	0.228	0.194	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
8	AFDB:F1R2D2	0.180	0.135	5.325E-49	1687	0.214	0.149	F1R2D2.pdb.gz
9	AFDB:A0A2R8QRK0	0.200	0.171	1.778E-48	1420	0.204	0.169	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
10	AFDB:O55005	0.177	0.137	1.982E-47	1651	0.202	0.144	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
11	PDB:5oj2B	0.158	0.233	3.669E-28	692	0.105	0.179	5oj2B.pdb.gz
12	PDB:1e07A	0.191	0.301	5.332E-21	642	0.100	0.184	1e07A.pdb.gz
13	PDB:6dldD	0.172	0.592	5.733E-15	269	0.061	0.268	6dldD.pdb.gz
14	PDB:7q1yA	0.105	0.097	1.182E-14	1374	0.081	0.070	7q1yA.pdb.gz
15	PDB:7q5zA	0.106	0.099	2.556E-14	1344	0.081	0.071	7q5zA.pdb.gz
16	PDB:7sqcO0	0.131	0.134	5.803E-14	1140	0.082	0.085	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:6dlfA	0.167	0.704	7.385E-14	236	0.062	0.309	6dlfA.pdb.gz
18	PDB:6h03A	0.116	0.114	1.099E-12	1223	0.067	0.065	6h03A.pdb.gz
19	PDB:5a42A	0.094	0.076	2.619E-12	1597	0.073	0.054	5a42A.pdb.gz
20	PDB:4lnvA	0.116	0.112	5.144E-12	1276	0.058	0.053	4lnvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZB51	0.0	736	1328	0.351	0.312	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
2	E9PZ19	0.0	736	1328	0.351	0.312	TUTLB_MOUSE Protein turtle homolog B OS=Mus musculus OX=10090 GN=Igsf9b PE=1 SV=1
3	Q05BQ1	0.0	1977	1179	0.878	0.878	TUTLA_MOUSE Protein turtle homolog A OS=Mus musculus OX=10090 GN=Igsf9 PE=1 SV=2
4	Q9P2J2	0.0	2348	1179	1.000	1.000	TUTLA_HUMAN Protein turtle homolog A OS=Homo sapiens OX=9606 GN=IGSF9 PE=1 SV=2
5	Q967D7	3.76e-117	400	1531	0.216	0.167	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
6	Q9U4G1	9.24e-58	215	719	0.128	0.210	BDL_DROME Protein borderless OS=Drosophila melanogaster OX=7227 GN=bdl PE=1 SV=1
7	E7F3V2	5.30e-33	142	4212	0.103	0.029	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
8	Q9HCK4	3.37e-32	139	1378	0.146	0.125	ROBO2_HUMAN Roundabout homolog 2 OS=Homo sapiens OX=9606 GN=ROBO2 PE=1 SV=2
9	D3YXG0	2.93e-30	133	5634	0.098	0.020	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
10	A0A0B4K7T5	1.47e-29	130	2033	0.137	0.080	A0A0B4K7T5_DROME Down syndrome cell adhesion molecule 1, isoform BJ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
11	Q96RW7	1.58e-29	130	5635	0.106	0.022	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
12	A0A8I6A1P7	1.99e-29	130	1377	0.144	0.123	A0A8I6A1P7_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=1
13	Q0E9L7	4.57e-29	129	2034	0.136	0.079	Q0E9L7_DROME Down syndrome cell adhesion molecule 1, isoform AW OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
14	Q7TPD3	5.34e-29	128	1470	0.146	0.117	ROBO2_MOUSE Roundabout homolog 2 OS=Mus musculus OX=10090 GN=Robo2 PE=1 SV=2
15	Q0E9H5	5.70e-29	128	2031	0.136	0.079	Q0E9H5_DROME Down syndrome cell adhesion molecule 1, isoform F OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
16	Q8VHZ8	8.83e-29	128	2013	0.117	0.069	DSCAM_RAT Cell adhesion molecule DSCAM OS=Rattus norvegicus OX=10116 GN=Dscam PE=1 SV=1
17	Q9ERC8	8.90e-29	128	2013	0.117	0.069	DSCAM_MOUSE Cell adhesion molecule DSCAM OS=Mus musculus OX=10090 GN=Dscam PE=1 SV=1
18	A0A8I6AKD6	4.12e-28	125	1381	0.144	0.123	A0A8I6AKD6_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=1
19	A0A0G2JZA1	4.22e-28	125	1472	0.144	0.115	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
20	A0A0B4K827	6.02e-28	125	2028	0.135	0.078	A0A0B4K827_DROME Down syndrome cell adhesion molecule 1, isoform BM OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	14	17.4	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	0.086	24.2	CD80-like C2-set immunoglobulin domain
3	PF00041 fn3	1.1e-13	62.6	Fibronectin type III domain
4	PF07679 I-set	3.3e-38	141.0	Immunoglobulin I-set domain
5	PF00047 ig	1.1e-28	110.6	Immunoglobulin domain
6	PF13895 Ig_2	3.1e-30	115.6	Immunoglobulin domain
7	PF13927 Ig_3	8.4e-52	185.0	Immunoglobulin domain
8	PF16680 Ig_4	22	17.0	T-cell surface glycoprotein CD3 delta chain
9	PF18452 Ig_6	0.61	21.4	Immunoglobulin domain
10	PF07686 V-set	2.3e-16	71.3	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357073

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417658	0.801	Patched domain-containing protein 3
2	9606.ENSP00000296786	0.717	Ubiquitin-like domain-containing CTD phosphatase 1
3	9606.ENSP00000289707	0.704	SLAM family member 8
4	9606.ENSP00000343288	0.660	Forkhead box protein N3
5	9606.ENSP00000362376	0.628	Uncharacterized protein FAM241B
6	9606.ENSP00000318684	0.623	V-set and immunoglobulin domain containing 2
7	9606.ENSP00000268154	0.604	Zinc finger protein 710
8	9606.ENSP00000456548	0.545	Protein ELFN1
9	9606.ENSP00000261918	0.524	Semaphorin-7A
10	9606.ENSP00000354387	0.511	Nicotinamide riboside kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050839	0.464	cell adhesion molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0065007	0.989	biological regulation
GO:0050794	0.981	regulation of cellular process
GO:0032502	0.980	developmental process
GO:0032501	0.969	multicellular organismal process
GO:0048856	0.919	anatomical structure development
GO:0007275	0.883	multicellular organism development
GO:0016043	0.867	cellular component organization
GO:0048731	0.790	system development
GO:0048869	0.719	cellular developmental process
GO:0007399	0.675	nervous system development
GO:0030154	0.667	cell differentiation
GO:0065008	0.599	regulation of biological quality
GO:0007155	0.560	cell adhesion
GO:0048468	0.412	cell development
GO:0051128	0.341	regulation of cellular component organization
GO:0050896	0.333	response to stimulus
GO:0048699	0.321	generation of neurons
GO:0030182	0.311	neuron differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0043226	0.869	organelle
GO:0016020	0.843	membrane
GO:0120025	0.839	plasma membrane bounded cell projection
GO:0030054	0.825	cell junction
GO:0043005	0.792	neuron projection
GO:0005622	0.726	intracellular anatomical structure
GO:0043231	0.707	intracellular membrane-bounded organelle
GO:0071944	0.627	cell periphery
GO:0005886	0.573	plasma membrane
GO:0045202	0.507	synapse
GO:0036477	0.445	somatodendritic compartment
GO:0030424	0.331	axon
GO:0030425	0.306	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]