StarFunc result for job id Q9P2J5

User Input

>input (1176 residues)
MAERKGTAKVDFLKKIEKEIQQKWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLH
LGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPDE
EEEEEETSVKTEDIIIKDKAKGKKSKAAAKAGSSKYQWGIMKSLGLSDEEIVKFSEAEHW
LDYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIY
SPKDGQPCMDHDRQTGEGVGPQEYTLLKLKVLEPYPSKLSGLKGKNIFLVAATLRPETMF
GQTNCWVRPDMKYIGFETVNGDIFICTQKAARNMSYQGFTKDNGVVPVVKELMGEEILGA
SLSAPLTSYKVIYVLPMLTIKEDKGTGVVTSVPSDSPDDIAALRDLKKKQALRAKYGIRD
DMVLPFEPVPVIEIPGFGNLSAVTICDELKIQSQNDREKLAEAKEKIYLKGFYEGIMLVD
GFKGQKVQDVKKTIQKKMIDAGDALIYMEPEKQVMSRSSDECVVALCDQWYLDYGEENWK
KQTSQCLKNLETFCEETRRNFEATLGWLQEHACSRTYGLGTHLPWDEQWLIESLSDSTIY
MAFYTVAHLLQGGNLHGQAESPLGIRPQQMTKEVWDYVFFKEAPFPKTQIAKEKLDQLKQ
EFEFWYPVDLRVSGKDLVPNHLSYYLYNHVAMWPEQSDKWPTAVRANGHLLLNSEKMSKS
TGNFLTLTQAIDKFSADGMRLALADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMVAN
WDSLRSGPASTFNDRVFASELNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELAV
EGMHRELVFRFIEVQTLLLAPFCPHLCEHIWTLLGKPDSIMNASWPVAGPVNEVLIHSSQ
YLMEVTHDLRLRLKNYMMPAKGKKTDKQPLQKPSHCTIYVAKNYPPWQHTTLSVLRKHFE
ANNGKLPDNKVIASELGSMPELKKYMKKVMPFVAMIKENLEKMGPRILDLQLEFDEKAVL
MENIVYLTNSLELEHIEVKFASEAEDKIREDCCPGKPLNVFRIEPGVSVSLVNPQPSNGH
FSTKIEIRQGDNCDSIIRRLMKMNRGIKDLSKVKLMRFDDPLLGPRRVPVLGKEYTEKTP
ISEHAVFNVDLMSKKIHLTENGIRVDIGDTIIYLVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6lpfB	0.824	0.959	0.000	1006	0.855	0.999	6lpfB.pdb.gz	Molecular basis of the multifaceted functions of human leucyl-tRNA synthetase in protein synthesis and beyond.
2	AFDB:A0A1D8PS12	0.821	0.877	0.000	1097	0.426	0.457	A0A1D8PS12.pdb.gz	A0A1D8PS12_CANAL leucine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC60 PE=4 SV=1
3	AFDB:A0A6I8PLB3	0.830	0.951	0.000	1024	0.870	0.999	A0A6I8PLB3.pdb.gz	A0A6I8PLB3_HUMAN leucine--tRNA ligase OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=1
4	AFDB:B4DER1	0.959	0.981	0.000	1149	0.971	0.994	B4DER1.pdb.gz	B4DER1_HUMAN leucine--tRNA ligase OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=1
5	AFDB:F4I116	0.835	0.897	0.000	1091	0.440	0.474	F4I116.pdb.gz	SYLC_ARATH Leucine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At1g09620 PE=1 SV=1
6	AFDB:P26637	0.818	0.880	0.000	1090	0.414	0.447	P26637.pdb.gz	SYLC_YEAST Leucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC60 PE=1 SV=1
7	AFDB:Q09996	0.938	0.930	0.000	1186	0.563	0.558	Q09996.pdb.gz	SYLC_CAEEL Leucine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=lars-1 PE=3 SV=2
8	AFDB:Q10490	0.819	0.864	0.000	1111	0.451	0.477	Q10490.pdb.gz	SYLC_SCHPO Putative leucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lrs1 PE=1 SV=1
9	AFDB:Q5PPJ6	0.998	0.996	0.000	1178	0.901	0.899	Q5PPJ6.pdb.gz	Q5PPJ6_RAT leucine--tRNA ligase OS=Rattus norvegicus OX=10116 GN=Lars1 PE=1 SV=1
10	AFDB:Q8MRF8	0.938	0.933	0.000	1182	0.594	0.591	Q8MRF8.pdb.gz	Q8MRF8_DROME leucine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=LeuRS PE=2 SV=1
11	AFDB:O27552	0.691	0.857	1.296E-72	937	0.247	0.309	O27552.pdb.gz	SYL_METTH Leucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=leuS PE=1 SV=1
12	PDB:7d5cA	0.406	0.505	5.923E-30	919	0.136	0.174	7d5cA.pdb.gz	Inhibitory mechanism of reveromycin A at the tRNA binding site of a class I synthetase.
13	PDB:4ariA	0.362	0.486	4.748E-22	821	0.139	0.200	4ariA.pdb.gz	Structural Dynamics of the Aminoacylation and Proofreading Functional Cycle of Bacterial Leucyl-tRNA Synthetase
14	PDB:3zgzD	0.365	0.469	3.343E-21	867	0.137	0.186	3zgzD.pdb.gz	Plant Tumour Biocontrol Agent Employs a tRNA-Dependent Mechanism to Inhibit Leucyl-tRNA Synthetase
15	PDB:6ax8A	0.317	0.673	3.632E-9	509	0.071	0.163	6ax8A.pdb.gz	The crystal structure of the drug target Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with a catalytic intermediate.
16	PDB:1u0bB	0.107	0.245	4.924E-5	461	0.036	0.091	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
17	PDB:1li7B	0.102	0.276	1.498E-3	375	0.023	0.072	1li7B.pdb.gz	Structural origins of amino acid selection without editing by cysteinyl-tRNA synthetase
18	PDB:7rbsB	0.056	0.354	3.751E-2	157	0.013	0.096	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
19	PDB:6yvaC	0.054	0.348	5.278E-2	155	0.013	0.097	6yvaC.pdb.gz
20	PDB:6mdhA	0.055	0.355	7.074E-2	149	0.009	0.074	6mdhA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PS12	0.0	947	1097	0.435	0.466	A0A1D8PS12_CANAL leucine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC60 PE=4 SV=1
2	A0A6I8PIT3	0.0	2420	1164	0.990	1.000	A0A6I8PIT3_HUMAN leucine--tRNA ligase OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=1
3	A0A6I8PIV1	0.0	2446	1175	0.999	1.000	A0A6I8PIV1_HUMAN leucine--tRNA ligase OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=1
4	A0A6I8PL42	0.0	2338	1130	0.961	1.000	A0A6I8PL42_HUMAN leucine--tRNA ligase OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=1
5	A0A6I8PLB3	0.0	1707	1024	0.700	0.804	A0A6I8PLB3_HUMAN leucine--tRNA ligase OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=1
6	A0A6I8PRS0	0.0	2333	1121	0.953	1.000	A0A6I8PRS0_HUMAN leucine--tRNA ligase OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=1
7	A0A6I8PS05	0.0	2150	1049	0.878	0.984	A0A6I8PS05_HUMAN leucine--tRNA ligase OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=1
8	B4DER1	0.0	2378	1149	0.977	1.000	B4DER1_HUMAN leucine--tRNA ligase OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=1
9	F4I116	0.0	1025	1091	0.443	0.478	SYLC_ARATH Leucine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At1g09620 PE=1 SV=1
10	P26637	0.0	890	1090	0.418	0.451	SYLC_YEAST Leucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC60 PE=1 SV=1
11	Q09996	0.0	1318	1186	0.567	0.562	SYLC_CAEEL Leucine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=lars-1 PE=3 SV=2
12	Q10490	0.0	980	1111	0.451	0.477	SYLC_SCHPO Putative leucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lrs1 PE=1 SV=1
13	Q5PPJ6	0.0	2204	1178	0.901	0.900	Q5PPJ6_RAT leucine--tRNA ligase OS=Rattus norvegicus OX=10116 GN=Lars1 PE=1 SV=1
14	Q8BMJ2	0.0	2203	1178	0.902	0.901	SYLC_MOUSE Leucine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Lars1 PE=1 SV=2
15	Q8MRF8	0.0	1439	1182	0.594	0.591	Q8MRF8_DROME leucine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=LeuRS PE=2 SV=1
16	Q9P2J5	0.0	2451	1176	1.000	1.000	SYLC_HUMAN Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2
17	Q9VQR8	0.0	1437	1182	0.593	0.590	Q9VQR8_DROME leucine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=LeuRS PE=1 SV=2
18	O27552	4.53e-127	415	937	0.253	0.317	SYL_METTH Leucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=leuS PE=1 SV=1
19	P07118	2.90e-10	67.4	951	0.062	0.077	SYV_ECOLI Valine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=valS PE=1 SV=2
20	P07813	4.00e-09	63.5	860	0.028	0.038	SYL_ECOLI Leucine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=leuS PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08264 Anticodon_1	5.4e-14	63.9	Anticodon-binding domain of tRNA ligase
2	PF00133 tRNA-synt_1	1.6e-36	137.5	tRNA synthetases class I (I, L, M and V)
3	PF01406 tRNA-synt_1e	0.005	27.8	tRNA synthetases class I (C) catalytic domain
4	PF09334 tRNA-synt_1g	2.5e-14	64.5	tRNA synthetases class I (M)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377954

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231572	0.999	Arginine--tRNA ligase, cytoplasmic
2	9606.ENSP00000262027	0.999	Methionine--tRNA ligase, cytoplasmic
3	9606.ENSP00000264161	0.999	Aspartate--tRNA ligase, cytoplasmic
4	9606.ENSP00000307567	0.999	Glutamine--tRNA ligase
5	9606.ENSP00000325448	0.999	Lysine--tRNA ligase
6	9606.ENSP00000355890	0.999	Bifunctional glutamate/proline--tRNA ligase
7	9606.ENSP00000364794	0.999	Isoleucine--tRNA ligase, cytoplasmic
8	9606.ENSP00000378191	0.997	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1
9	9606.ENSP00000223029	0.995	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
10	9606.ENSP00000369038	0.995	Eukaryotic translation elongation factor 1 epsilon-1
11	9606.ENSP00000441000	0.993	Valine--tRNA ligase, mitochondrial
12	9606.ENSP00000364815	0.988	Valine--tRNA ligase
13	9606.ENSP00000362576	0.986	Tyrosine--tRNA ligase, cytoplasmic
14	9606.ENSP00000256854	0.984	Asparagine--tRNA ligase, cytoplasmic
15	9606.ENSP00000261772	0.984	Alanine--tRNA ligase, cytoplasmic
16	9606.ENSP00000369897	0.976	Cysteine--tRNA ligase, cytoplasmic
17	9606.ENSP00000355889	0.973	Isoleucine--tRNA ligase, mitochondrial
18	9606.ENSP00000338093	0.972	Probable threonine--tRNA ligase 2, cytoplasmic
19	9606.ENSP00000360327	0.971	Probable proline--tRNA ligase, mitochondrial
20	9606.ENSP00000282276	0.947	Methionine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004823	1.000	leucine-tRNA ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0044238	0.986	primary metabolic process
GO:0006418	0.975	tRNA aminoacylation for protein translation
GO:0065007	0.502	biological regulation
GO:0050789	0.475	regulation of biological process
GO:0050794	0.470	regulation of cellular process
GO:0050896	0.379	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0016604	0.987	nuclear body
GO:0032991	0.853	protein-containing complex
GO:0016020	0.530	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11688	1.000	ATP + L-leucine + tRNA(Leu) = AMP + diphosphate + L-leucyl-tRNA(Leu)
EC:6.1.1.4	1.000	leucine--tRNA ligase.

[back to server]