StarFunc result for job id Q9P2J8

User Input

>input (865 residues)
MSLQDSTLSREGKPEGEIMAAVFFSVGRLSPEVTQPDEDLHLQAEETQLVKESVTFKDVA
IDFTLEEWRLMDPTQRNLHKDVMLENYRNLVSLGLAVSKPDMISHLENGKGPWVTVREIS
RIPYPDMEPKPATKKATRTKAISEDLSQEAILEKLTENGLWDSRMEGLWKWNDRILRLQN
NQENHLSQRIIPLKKTPTSQRGFRFESILIPEPGIATEELHSRCQTQEENFTENLNLITD
THLGKIICKEMKGSKAIRQTSELTLGKKSNNKEKPYKCSTCEKAFHYRSLLIQHQRTHTK
EKPYECNECGKTFSQPSYLSQHKKIHTGEKPYKCNECGKAFIASSSLMVHQRIHTKEKPY
QCNVCGKSFSQCARLNQHQRIQTGEKPYKCSECGKAFSDKSKLARHQETHNGEKPYKCDD
CGKAFRNKSYLSVHQKTHTEEKPYQCNECGKSFKNTTIFNVHQRIHTGEKPFRCNECGKA
YRSNSSLIVHIRTHTGEKPYECNECGKAFNRIANFTEHQRIHTGEKPYKCNECGKAFINY
SCLTVHHRMHTGEKPYKCTECGKAFMRSSSLIIHQRIHTEEKPYLCNECGESFRIKSHLT
VHQRIHTGEKPYKCTDCERAFTKMVNLKEHQKIHTGVKPYKCYDCGKSFRTKSYLIVHQR
THTGEKPYKCNECEKAFTNTSQLTVHQRRHTGEKPYKCNECGKVFTSNSGFNTHQRTHTG
EKPFKCNDCGKAFSQMVHVTEHQKIHSGEKPYKCDVCGKAFRRGSYLTVHWRTHTGEKPY
TCKECGKGCITLSQLTLHQRIHTGERPYKCEECGKAFRTNSDFTVHLRMHTGEKPYKCNE
CGKAFRSSSSLTVHQRIHQRETQLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2J8	1.000	1.000	0.000	865	1.000	1.000	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
2	AFDB:Q14587	0.489	0.454	1.103E-79	947	0.473	0.432	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
3	AFDB:Q5TYW1	0.517	0.431	2.185E-70	1059	0.464	0.379	Q5TYW1.pdb.gz	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
4	AFDB:Q5MCW4	0.432	0.528	5.981E-69	686	0.403	0.509	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
5	AFDB:Q96SK3	0.363	0.441	6.128E-68	696	0.392	0.487	Q96SK3.pdb.gz	ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens OX=9606 GN=ZNF607 PE=1 SV=3
6	AFDB:Q9Y3M9	0.427	0.484	4.848E-67	751	0.353	0.406	Q9Y3M9.pdb.gz	ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2
7	AFDB:Q8TAQ5	0.441	0.538	8.562E-67	688	0.435	0.547	Q8TAQ5.pdb.gz	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
8	AFDB:Q62788	0.311	0.354	3.459E-66	744	0.390	0.453	Q62788.pdb.gz	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
9	AFDB:Q6ZR52	0.446	0.568	2.598E-65	646	0.371	0.497	Q6ZR52.pdb.gz	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
10	AFDB:Q9UII5	0.287	0.309	8.988E-65	783	0.387	0.428	Q9UII5.pdb.gz	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
11	PDB:3w5kB	0.064	0.276	4.747E-4	110	0.051	0.400	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6hivCv	0.047	0.042	9.016E-1	1059	0.076	0.062	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
13	PDB:7ena4	0.056	0.081	1.109	457	0.060	0.114	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	PDB:7o4iW	0.031	0.067	1.436	312	0.031	0.087	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
15	PDB:6o9lQ	0.044	0.077	1.677	430	0.040	0.081	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
16	PDB:5gm6a	0.027	0.120	1.766	123	0.034	0.236	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:4kfzB	0.042	0.150	2.287	148	0.024	0.142	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
18	PDB:5iv5O	0.041	0.059	2.812	526	0.039	0.065	5iv5O.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
19	PDB:6gejS	0.040	0.108	2.812	208	0.039	0.163	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
20	PDB:6ff4t	0.029	0.085	2.962	172	0.031	0.157	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WSF4	570	635	0.311	0.424	A0A087WSF4_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
2	A0A0A0MS50	545	604	0.342	0.490	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
3	A0A0U1RQ46	565	609	0.318	0.452	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
4	A0A1B0GR71	557	966	0.399	0.357	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
5	A0A8I6G8Y2	586	723	0.331	0.396	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
6	A2AWF2	540	685	0.341	0.431	A2AWF2_MOUSE Reduced expression 2 OS=Mus musculus OX=10090 GN=Rex2 PE=1 SV=1
7	A6NNF4	571	616	0.363	0.510	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
8	A8K8Y5	579	707	0.327	0.400	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
9	E9Q981	570	636	0.311	0.423	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
10	F8WEC7	569	859	0.383	0.385	F8WEC7_HUMAN Zinc finger protein 473 OS=Homo sapiens OX=9606 GN=ZNF473 PE=1 SV=1
11	G3V9G6	587	740	0.331	0.386	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
12	O75290	536	641	0.288	0.388	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
13	O75437	561	659	0.368	0.483	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
14	P15620	543	580	0.305	0.455	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
15	P17014	605	697	0.393	0.488	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
16	P17020	540	682	0.314	0.399	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
17	P17021	538	662	0.313	0.409	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
18	P17027	558	643	0.321	0.432	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
19	P17038	716	809	0.457	0.488	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
20	P17097	564	686	0.363	0.458	ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens OX=9606 GN=ZNF7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	3.2	19.4	TFIIH C1-like domain
2	PF20026 DUF6434	79	14.7	Domain of unknown function (DUF6434)
3	PF01352 KRAB	1.1e-21	87.4	KRAB box
4	PF00628 PHD	51	15.2	PHD-finger
5	PF01286 XPA_N	5.6e-08	44.0	XPA protein N-terminal
6	PF01428 zf-AN1	2.3e+02	13.3	AN1-like Zinc finger
7	PF00096 zf-C2H2	8.4e-122	402.4	Zinc finger, C2H2 type
8	PF16622 zf-C2H2_11	3.8e-06	37.9	zinc-finger C2H2-type
9	PF13894 zf-C2H2_4	4.3e-62	212.3	C2H2-type zinc finger
10	PF13912 zf-C2H2_6	1.1e-20	84.3	C2H2-type zinc finger
11	PF12171 zf-C2H2_jaz	5.1e-08	44.2	Zinc-finger double-stranded RNA-binding
12	PF16278 zf-C2HE	14	17.6	C2HE / C2H2 / C2HC zinc-binding finger
13	PF13465 zf-H2C2_2	2.1e-158	519.8	Zinc-finger double domain
14	PF18439 zf_UBZ	0.015	26.2	Ubiquitin-Binding Zinc Finger
15	PF17032 zinc_ribbon_15	0.0031	29.5	zinc-ribbon family
16	PF14369 zinc_ribbon_9	1.5e+02	14.0	zinc-ribbon
17	PF09723 Zn-ribbon_8	8e-21	85.2	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 59538.XP_005964621.1

Rank	PPI partner	STRING score	Description
1	59538.XP_005960033.1	0.524	Uncharacterized protein LOC102340892
2	59538.XP_005982844.1	0.524	Uncharacterized protein LOC102336448
3	59538.XP_005983198.1	0.508	Polycomb protein SUZ12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003677	0.783	DNA binding
GO:0043565	0.483	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0051252	0.945	regulation of RNA metabolic process
GO:0010468	0.911	regulation of gene expression
GO:2001141	0.889	regulation of RNA biosynthetic process
GO:0051172	0.856	negative regulation of nitrogen compound metabolic process
GO:0010605	0.855	negative regulation of macromolecule metabolic process
GO:0048523	0.848	negative regulation of cellular process
GO:0006355	0.697	regulation of DNA-templated transcription
GO:0031324	0.559	negative regulation of cellular metabolic process
GO:0009987	0.538	cellular process
GO:0009890	0.396	negative regulation of biosynthetic process
GO:0045892	0.391	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.910	intracellular non-membrane-bounded organelle
GO:0005737	0.536	cytoplasm
GO:0032991	0.451	protein-containing complex
GO:0005829	0.441	cytosol
GO:0005730	0.325	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]