StarFunc result for job id Q9P2J9

User Input

>input (529 residues)
MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLC
KAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPV
EDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESM
KPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDS
DISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMW
SCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQ
RSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSN
EDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIG
NNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2J9	1.000	1.000	5.728E-98	529	1.000	1.000	Q9P2J9.pdb.gz	PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDP2 PE=2 SV=2
2	AFDB:Q5DTY5	0.889	0.873	1.035E-84	539	0.847	0.831	Q5DTY5.pdb.gz	Q5DTY5_MOUSE MKIAA1348 protein (Fragment) OS=Mus musculus OX=10090 GN=Pdp2 PE=2 SV=1
3	AFDB:O88483	0.806	0.793	1.206E-61	538	0.484	0.476	O88483.pdb.gz	PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdp1 PE=1 SV=1
4	AFDB:Q9W3Q1	0.732	0.812	1.610E-45	475	0.335	0.373	Q9W3Q1.pdb.gz	Q9W3Q1_DROME GM14286p OS=Drosophila melanogaster OX=7227 GN=Pdp PE=1 SV=1
5	AFDB:Q5B158	0.615	0.548	1.142E-34	596	0.299	0.265	Q5B158.pdb.gz	Q5B158_EMENI Protein phophatase 2C family protein (AFU_orthologue AFUA_1G06860) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05722 PE=4 SV=1
6	AFDB:O14189	0.606	0.715	1.347E-30	444	0.246	0.293	O14189.pdb.gz	PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC10F6.17c PE=3 SV=4
7	AFDB:Q12511	0.605	0.561	1.316E-28	572	0.244	0.226	Q12511.pdb.gz	PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PTC5 PE=1 SV=1
8	AFDB:Q9LUS8	0.467	0.497	1.088E-21	493	0.174	0.187	Q9LUS8.pdb.gz	P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana OX=3702 GN=At3g16560 PE=1 SV=1
9	AFDB:Q9LQN6	0.482	0.394	2.420E-21	662	0.204	0.163	Q9LQN6.pdb.gz	P2C04_ARATH Probable protein phosphatase 2C 4 OS=Arabidopsis thaliana OX=3702 GN=PLL5 PE=2 SV=1
10	AFDB:Q9ZV25	0.452	0.375	1.404E-20	654	0.197	0.159	Q9ZV25.pdb.gz	P2C23_ARATH Probable protein phosphatase 2C 23 OS=Arabidopsis thaliana OX=3702 GN=PLL4 PE=2 SV=1
11	PDB:4oicB	0.383	0.637	6.771E-16	305	0.180	0.311	4oicB.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
12	PDB:1a6qA	0.417	0.595	4.860E-15	363	0.129	0.187	1a6qA.pdb.gz	Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
13	PDB:5nzzD	0.361	0.489	7.355E-14	379	0.140	0.195	5nzzD.pdb.gz	The TAB1-p38 alpha complex aggravates myocardial injury and can be targeted by small molecules.
14	PDB:7kprA	0.405	0.516	2.135E-13	403	0.178	0.233	7kprA.pdb.gz	Structural basis for the specificity of PPM1H phosphatase for Rab GTPases.
15	PDB:4jndA	0.368	0.467	1.798E-12	408	0.132	0.172	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.
16	PDB:2pk0A	0.268	0.526	7.802E-10	247	0.129	0.275	2pk0A.pdb.gz	Structure of Streptococcus agalactiae serine/threonine phosphatase. The subdomain conformation is coupled to the binding of a third metal ion
17	PDB:5d2uA	0.291	0.602	8.940E-8	240	0.091	0.200	5d2uA.pdb.gz	Structural and Biochemical Characterization of a Cyanobacterial PP2C Phosphatase Reveals Insights into Catalytic Mechanism and Substrate Recognition
18	PDB:6jkvA	0.280	0.578	3.386E-7	230	0.110	0.252	6jkvA.pdb.gz	Crystal structure of PppA from Pseudomonas aeruginosa, a key regulatory component of type VI secretion systems.
19	PDB:3w40A	0.245	0.579	8.179E-5	199	0.078	0.206	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
20	PDB:6rreD	0.258	0.307	3.996E-3	427	0.083	0.103	6rreD.pdb.gz	Structural insight into the membrane targeting domain of the Legionella deAMPylase SidD.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88484	0.0	926	530	0.837	0.836	PDP2_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdp2 PE=2 SV=1
2	Q504M2	0.0	934	532	0.853	0.848	Q504M2_MOUSE Pyruvate dehydrogenase phosphatase catalytic subunit 2 OS=Mus musculus OX=10090 GN=Pdp2 PE=1 SV=1
3	Q5DTY5	0.0	933	539	0.853	0.837	Q5DTY5_MOUSE MKIAA1348 protein (Fragment) OS=Mus musculus OX=10090 GN=Pdp2 PE=2 SV=1
4	Q9P2J9	0.0	1102	529	1.000	1.000	PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDP2 PE=2 SV=2
5	P35816	4.37e-180	519	538	0.486	0.478	PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus OX=9913 GN=PDP1 PE=1 SV=1
6	Q9P0J1	1.05e-179	518	537	0.486	0.479	PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PDP1 PE=1 SV=3
7	Q3UV70	3.28e-179	516	538	0.484	0.476	PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus OX=10090 GN=Pdp1 PE=1 SV=1
8	O88483	9.89e-178	513	538	0.480	0.472	PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdp1 PE=1 SV=1
9	Q9W3Q1	3.87e-94	296	475	0.346	0.385	Q9W3Q1_DROME GM14286p OS=Drosophila melanogaster OX=7227 GN=Pdp PE=1 SV=1
10	Q5B158	1.12e-50	185	596	0.287	0.255	Q5B158_EMENI Protein phophatase 2C family protein (AFU_orthologue AFUA_1G06860) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05722 PE=4 SV=1
11	O14189	7.34e-49	176	444	0.250	0.297	PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC10F6.17c PE=3 SV=4
12	Q5A388	5.12e-47	174	580	0.272	0.248	Q5A388_CANAL Type 2C protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PTC5 PE=3 SV=1
13	Q12511	8.94e-41	157	572	0.244	0.226	PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PTC5 PE=1 SV=1
14	Q5PNS9	7.47e-23	102	400	0.151	0.200	P2C64_ARATH Probable protein phosphatase 2C 64 OS=Arabidopsis thaliana OX=3702 GN=PP2C64 PE=1 SV=1
15	Q9SD12	2.36e-21	98.2	379	0.140	0.195	P2C46_ARATH Probable protein phosphatase 2C 46 OS=Arabidopsis thaliana OX=3702 GN=PP2C46 PE=1 SV=1
16	Q501F9	1.87e-20	95.5	370	0.130	0.186	P2C67_ARATH Probable protein phosphatase 2C 67 OS=Arabidopsis thaliana OX=3702 GN=PP2C67 PE=1 SV=1
17	Q9LHJ9	2.03e-20	95.5	385	0.136	0.187	P2C38_ARATH Probable protein phosphatase 2C 38 OS=Arabidopsis thaliana OX=3702 GN=PP2C38 PE=1 SV=1
18	Q9FKX4	1.67e-19	92.8	385	0.140	0.192	P2C79_ARATH Probable protein phosphatase 2C 79 OS=Arabidopsis thaliana OX=3702 GN=PP2C79 PE=2 SV=1
19	Q0V7V2	1.93e-17	86.7	384	0.127	0.174	P2C42_ARATH Probable protein phosphatase 2C 42 OS=Arabidopsis thaliana OX=3702 GN=PP2C42 PE=1 SV=1
20	Q9LUS8	5.34e-17	85.9	493	0.153	0.164	P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana OX=3702 GN=At3g16560 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00481 PP2C	6.8e-35	132.5	Protein phosphatase 2C
2	PF13672 PP2C_2	3.5e+02	12.2	Protein phosphatase 2C

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309548

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307241	0.978	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
2	9606.ENSP00000280346	0.975	Dihydrolipoamide S-acetyltransferase
3	9606.ENSP00000205402	0.973	Dihydrolipoyl dehydrogenase, mitochondrial
4	9606.ENSP00000369134	0.973	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
5	9606.ENSP00000227868	0.969	Pyruvate dehydrogenase protein X component, mitochondrial
6	9606.ENSP00000295266	0.954	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
7	9606.ENSP00000288050	0.917	Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial
8	9606.ENSP00000346255	0.743	Protein phosphatase which positively regulates biosynthesis of the ubiquinone, coenzyme Q . Dephosphorylates the ubiquinone biosynthesis protein COQ7 which is likely to lead to its activation
9	9606.ENSP00000228705	0.716	Protein phosphatase 1H
10	9606.ENSP00000387219	0.702	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
11	9606.ENSP00000477341	0.698	Protein phosphatase 1K, mitochondrial
12	9606.ENSP00000360366	0.694	Acyl-coenzyme A thioesterase 11
13	9606.ENSP00000358262	0.686	Chromodomain-helicase-DNA-binding protein 1-like
14	9606.ENSP00000377115	0.678	Lipoyltransferase 1, mitochondrial
15	9606.ENSP00000376352	0.657	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial
16	9606.ENSP00000261434	0.652	Lipoyl synthase, mitochondrial
17	9606.ENSP00000387536	0.644	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial
18	9606.ENSP00000379503	0.613	[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
19	9606.ENSP00000385312	0.603	Mitochondrial thiamine pyrophosphate carrier
20	9606.ENSP00000373702	0.591	Protein phosphatase 2C like domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0004722	1.000	protein serine/threonine phosphatase activity
GO:0005515	0.983	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0016311	0.997	dephosphorylation
GO:1901564	0.991	organonitrogen compound metabolic process
GO:0036211	0.975	protein modification process
GO:0006470	0.970	protein dephosphorylation
GO:0050896	0.954	response to stimulus
GO:0006950	0.816	response to stress
GO:0065007	0.526	biological regulation
GO:0050789	0.453	regulation of biological process
GO:0009605	0.352	response to external stimulus
GO:0050794	0.327	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.939	intracellular organelle lumen
GO:0005634	0.595	nucleus
GO:0005759	0.501	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]