StarFunc result for job id Q9P2K1

User Input

>input (1620 residues)
MNPREEKVKIITEEFIENDEDADMGRQNKNSKVRRQPRKKQPPTAVPKEMVSEKSHLGNP
QEPVQEEPKTRLLSMTVRRGPRSLPPIPSTSRTGFAEFSMRGRMREKLQAARSKAESALL
QEIPTPRPRRLRSPSKKELETEFGTEPGKEVERTQQEVDSQSYSRVKFHDSARKIKPKPQ
VPPGFPSAEEAYNFFTFNFDPEPEGSEEKPKARHRAGTNQEEEEGEEEEPPAQGGGKEMD
EEELLNGDDAEDFLLGLDHVADDFVAVRPADYESIHDRLQMEREMLFIPSRQTVPTYKKL
PENVQPRFLEDEGLYTGVRPEVARTNQNIMENRLLMQDPERRWFGDDGRILALPNPIKPF
PSRPPVLTQEQSIKAELETLYKKAVKYVHSSQHVIRSGDPPGNFQLDIDISGLIFTHHPC
FSREHVLAAKLAQLYDQYLARHQRNKAKFLTDKLQALRNAVQTGLDPEKPHQSLDTIQKT
INEYKSEIRQTRKFRDAEQEKDRTLLKTIIKVWKEMKSLREFQRFTNTPLKLVLRKEKAD
QKADEEAYEAEIQAEISELLEEHTEEYAQKMEEYRTSLQQWKAWRKVQRAKKKKRKQAAE
EHPGDEIAEPYPEEDLVKPSPPEPTDRAVIEQEVRERAAQSRRRPWEPTLVPELSLAGSV
TPNDQCPRAEVSRREDVKKRSVYLKVLFNNKEVSRTVSRPLGADFRVHFGQIFNLQIVNW
PESLTLQVYETVGHSSPTLLAEVFLPIPETTVVTGRAPTEEVEFSSNQHVTLDHEGVGSG
VPFSFEADGSNQLTLMTSGKVSHSVAWAIGENGIPLIPPLSQQNIGFRSALKKADAISSI
GTSGLTDMKKLAKWAAESKLDPNDPNNAPLMQLISVATSGESYVPDFFRLEQLQQEFNFV
SDQELNRSKRFRLLHLRSQEVPEFRNYKQVPVYDREIMEKVFQDYEKRLRDRNVIETKEH
IDTHRAIVAKYLQQVRESVINRFLIAKQYFLLADMIVEEEVPNISILGLSLFKLAEQKRP
LRPRRKGRKKVTAQNLSDGDIKLLVNIVRAYDIPVRKPAVSKFQQPSRSSRMFSEKHAAS
PSTYSPTHNADYPLGQVLVRPFVEVSFQRTVCHTTTAEGPNPSWNEELELPFRAPNGDYS
TASLQSVKDVVFINIFDEVLHDVLEDDRERGSGIHTRIERHWLGCVKMPFSTIYFQARID
GTFKIDIPPVLLGYSKERNMILERGFDSVRSLSEGSYITLFITIEPQLVPGESIREKFES
QEDEKLLQATEKFQAECALKFPNRQCLTTVIDISGKTVFITRYLKPLNPPQELLNVYPNN
LQATAELVARYVSLIPFLPDTVSFGGICDLWSTSDQFLDLLAGDEEEHAVLLCNYFLSLG
KKAWLLMGNAIPEGPTAYVLTWEQGRYLIWNPCSGHFYGQFDTFCPLKNVGCLIGPDNIW
FNIQRYESPLRINFDVTRPKLWKSFFSRSLPYPGLSSVQPEELIYQRSDKAAAAELQDRI
EKILKEKIMDWRPRHLTRWNRYCTSTLRHFLPLLEKSQGEDVEDDHRAELLKQLGDYRFS
GFPLHMPYSEVKPLIDAVYSTGVHNIDVPNVEFALAVYIHPYPKNVLSVWIYVASLIRNR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2K1	1.000	1.000	0.000	1620	1.000	1.000	Q9P2K1.pdb.gz	C2D2A_HUMAN Coiled-coil and C2 domain-containing protein 2A OS=Homo sapiens OX=9606 GN=CC2D2A PE=1 SV=3
2	PDB:1cjyA	0.066	0.161	4.397E-6	633	0.035	0.090	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
3	PDB:7lq1A	0.067	0.109	3.552E-5	950	0.018	0.031	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
4	PDB:5iz5B	0.066	0.136	4.529E-5	746	0.014	0.031	5iz5B.pdb.gz
5	PDB:5iz5A	0.051	0.084	4.755E-5	757	0.030	0.063	5iz5A.pdb.gz
6	PDB:5a50A	0.066	0.534	5.501E-5	165	0.021	0.206	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
7	PDB:5ixcA	0.064	0.146	3.163E-4	684	0.014	0.034	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
8	PDB:3nsjA	0.063	0.177	6.556E-4	530	0.019	0.058	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
9	PDB:4rj9A	0.063	0.524	6.556E-4	161	0.020	0.199	4rj9A.pdb.gz
10	AFDB:X2JC00	0.059	0.067	8.309E-4	1404	0.096	0.111	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
11	PDB:5izrC	0.056	0.133	9.670E-4	659	0.026	0.064	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
12	PDB:5a52A	0.062	0.532	1.426E-3	154	0.016	0.169	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
13	AFDB:B7Z0K1	0.048	0.067	6.092E-3	1137	0.081	0.116	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
14	AFDB:Q08562	0.045	0.046	3.860E-2	1619	0.052	0.052	Q08562.pdb.gz	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
15	AFDB:P47136	0.072	0.080	6.916E-2	1447	0.087	0.097	P47136.pdb.gz	BUD4_YEAST Bud site selection protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD4 PE=1 SV=2
16	AFDB:Q8K298	0.058	0.080	1.301E-1	1121	0.093	0.134	Q8K298.pdb.gz	ANLN_MOUSE Anillin OS=Mus musculus OX=10090 GN=Anln PE=1 SV=2
17	AFDB:Q1LUB2	0.066	0.093	2.220E-1	1089	0.092	0.137	Q1LUB2.pdb.gz
18	AFDB:Q9HCH5	0.042	0.070	2.696E-1	934	0.071	0.123	Q9HCH5.pdb.gz	SYTL2_HUMAN Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2 PE=1 SV=3
19	AFDB:Q99N50	0.043	0.070	5.866E-1	950	0.077	0.132	Q99N50.pdb.gz	SYTL2_MOUSE Synaptotagmin-like protein 2 OS=Mus musculus OX=10090 GN=Sytl2 PE=1 SV=2
20	AFDB:F4J6V1	0.030	0.030	6.786E-1	1656	0.096	0.094	F4J6V1.pdb.gz	F4J6V1_ARATH Duplicated homeodomain-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=PWR PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CFW7	0.0	2730	1633	0.855	0.848	C2D2A_MOUSE Coiled-coil and C2 domain-containing protein 2A OS=Mus musculus OX=10090 GN=Cc2d2a PE=1 SV=1
2	Q9P2K1	0.0	3343	1620	1.000	1.000	C2D2A_HUMAN Coiled-coil and C2 domain-containing protein 2A OS=Homo sapiens OX=9606 GN=CC2D2A PE=1 SV=3
3	A1ZAV1	2.17e-63	240	1336	0.106	0.128	C2D2A_DROME Coiled-coil and C2 domain-containing protein 2A OS=Drosophila melanogaster OX=7227 GN=Cc2d2a PE=1 SV=2
4	Q21303	4.08e-36	152	1202	0.090	0.121	Q21303_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mks-6 PE=4 SV=1
5	Q38F79	5.90e-29	129	1608	0.085	0.085	Q38F79_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3240 PE=4 SV=1
6	Q8TAP6	7.55e-10	66.2	659	0.048	0.117	CEP76_HUMAN Centrosomal protein of 76 kDa OS=Homo sapiens OX=9606 GN=CEP76 PE=1 SV=1
7	Q384E2	3.71e-09	63.9	632	0.041	0.106	Q384E2_TRYB2 CEP76 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0600 PE=4 SV=1
8	Q8I4Z1	4.13e-07	57.8	1846	0.040	0.035	Q8I4Z1_PLAF7 Double C2-like domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1243900 PE=4 SV=1
9	F6IA09	0.96	36.6	2088	0.031	0.024	F6IA09_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=1
10	Q9NZM1	1.1	36.6	2061	0.019	0.015	MYOF_HUMAN Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1
11	D4A6X1	1.4	36.2	2029	0.010	0.008	D4A6X1_RAT Dysferlin OS=Rattus norvegicus OX=10116 GN=Dysf PE=3 SV=2
12	O75923	1.4	36.2	2080	0.010	0.008	DYSF_HUMAN Dysferlin OS=Homo sapiens OX=9606 GN=DYSF PE=1 SV=1
13	Q9ESD7	1.4	36.2	2090	0.010	0.008	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
14	O95347	2.0	35.8	1197	0.038	0.051	SMC2_HUMAN Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 PE=1 SV=2
15	Q69ZN7	2.2	35.4	2048	0.010	0.008	MYOF_MOUSE Myoferlin OS=Mus musculus OX=10090 GN=Myof PE=1 SV=2
16	Q8H0S3	2.3	35.4	783	0.015	0.032	SC23B_ARATH Protein transport protein SEC23 B OS=Arabidopsis thaliana OX=3702 GN=SEC23B PE=1 SV=1
17	C8CHL5	3.0	34.3	291	0.015	0.086	C8CHL5_9VIRU VP17 OS=Thermus virus P23-77 OX=1714272 PE=1 SV=1
18	G8BDA6	5.7	34.3	1071	0.020	0.030	G8BDA6_CANPC alpha,alpha-trehalase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=ATC1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	0.1	24.2	C2 domain
2	PF15625 CC2D2AN-C2	1.5e-57	205.6	CC2D2A N-terminal C2 domain
3	PF14024 DUF4240	8.4e+02	11.5	Protein of unknown function (DUF4240)
4	PF17661 DUF5523	1.7e-100	347.4	Family of unknown function (DUF5523)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000403465

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000448012	0.996	Centrosomal protein of 290 kDa
2	9606.ENSP00000261499	0.992	B9 domain-containing protein 1
3	9606.ENSP00000389998	0.991	Meckelin
4	9606.ENSP00000356774	0.990	Jouberin
5	9606.ENSP00000376827	0.985	Meckel syndrome type 1 protein
6	9606.ENSP00000440638	0.981	Transmembrane protein 216
7	9606.ENSP00000243578	0.980	B9 domain-containing protein 2
8	9606.ENSP00000304941	0.977	Tectonic-2
9	9606.ENSP00000380779	0.972	Tectonic-1
10	9606.ENSP00000258173	0.951	Transmembrane protein 231
11	9606.ENSP00000483364	0.951	Tectonic-3
12	9606.ENSP00000335094	0.949	Transmembrane protein 17
13	9606.ENSP00000369257	0.937	Protein fantom
14	9606.ENSP00000313169	0.903	Nephrocystin-1
15	9606.ENSP00000314116	0.875	Transmembrane protein 107
16	9606.ENSP00000377769	0.852	ADP-ribosylation factor-like protein 13B
17	9606.ENSP00000367398	0.833	Nephrocystin-4
18	9606.ENSP00000323580	0.786	Intraflagellar transport protein 88 homolog
19	9606.ENSP00000338766	0.768	Nephrocystin-3
20	9606.ENSP00000386264	0.757	Transmembrane protein 237

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016043	0.991	cellular component organization
GO:0044085	0.989	cellular component biogenesis
GO:0022607	0.975	cellular component assembly
GO:0044782	0.970	cilium organization
GO:0060271	0.964	cilium assembly
GO:0050789	0.960	regulation of biological process
GO:0050794	0.953	regulation of cellular process
GO:0032501	0.946	multicellular organismal process
GO:0048856	0.935	anatomical structure development
GO:0051179	0.928	localization
GO:0007017	0.925	microtubule-based process
GO:0007399	0.923	nervous system development
GO:0061512	0.922	protein localization to cilium
GO:0051716	0.900	cellular response to stimulus
GO:0002009	0.889	morphogenesis of an epithelium
GO:0048598	0.861	embryonic morphogenesis
GO:0035295	0.847	tube development
GO:0023052	0.843	signaling
GO:0007154	0.812	cell communication
GO:0035148	0.786	tube formation
GO:0016331	0.782	morphogenesis of embryonic epithelium
GO:0060562	0.775	epithelial tube morphogenesis
GO:0007224	0.763	smoothened signaling pathway
GO:0021915	0.763	neural tube development
GO:0007389	0.759	pattern specification process
GO:0007423	0.756	sensory organ development
GO:0001838	0.744	embryonic epithelial tube formation
GO:0014020	0.703	primary neural tube formation
GO:0003002	0.687	regionalization
GO:0048880	0.621	sensory system development
GO:0060606	0.599	tube closure
GO:0044458	0.487	motile cilium assembly
GO:0000226	0.450	microtubule cytoskeleton organization
GO:0007368	0.328	determination of left/right symmetry
GO:0001654	0.313	eye development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043227	0.996	membrane-bounded organelle
GO:0032991	0.990	protein-containing complex
GO:0120025	0.986	plasma membrane bounded cell projection
GO:0005929	0.980	cilium
GO:0043229	0.825	intracellular organelle
GO:0043232	0.620	intracellular non-membrane-bounded organelle
GO:0035869	0.391	ciliary transition zone
GO:0043231	0.390	intracellular membrane-bounded organelle
GO:0016020	0.345	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]