StarFunc result for job id Q9P2K3

User Input

>input (495 residues)
MRVGAEYQARIPEFDPGATKYTDKDNGGMLVWSPYHSIPDAKLDEYIAIAKEKHGYNVEQ
ALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKSFHRIQQMLPDKTI
ASLVKYYYSWKKTRSRTSLMDRQARKLANRHNQGDSDDDVEETHPMDGNDSDYDPKKEAK
KEGNTEQPVQTSKIGLGRREYQSLQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAANT
ILRQLDMELISLKRQVQNAKQVNSALKQKMEGGIEEFKPPESNQKINARWTTEEQLLAVQ
GVRKYGKDFQAIADVIGNKTVGQVKNFFVNYRRRFNLEEVLQEWEAEQGTQASNGDASTL
GEETKSASNVPSGKSTDEEEEAQTPQAPRTLGPSPPAPSSTPTPTAPIATLNQPPPLLRP
TLPAAPALHRQPPPLQQQARFIQPRPTLNQPPPPLIRPANSMPPRLNPRPVLSTVGGQQP
PSLIGIQTDSQSSLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2K3	0.999	0.999	8.939E-64	495	1.000	1.000	Q9P2K3.pdb.gz	RCOR3_HUMAN REST corepressor 3 OS=Homo sapiens OX=9606 GN=RCOR3 PE=1 SV=2
2	AFDB:Q6PGA0	0.243	0.261	1.394E-41	451	0.784	0.860	Q6PGA0.pdb.gz	RCOR3_MOUSE REST corepressor 3 OS=Mus musculus OX=10090 GN=Rcor3 PE=1 SV=2
3	AFDB:Q6NRZ0	0.317	0.313	8.588E-37	503	0.562	0.553	Q6NRZ0.pdb.gz	RCOR2_XENLA REST corepressor 2 OS=Xenopus laevis OX=8355 GN=rcor2 PE=2 SV=1
4	AFDB:A1L228	0.286	0.308	3.950E-33	458	0.485	0.524	A1L228.pdb.gz	A1L228_DANRE REST corepressor 1 OS=Danio rerio OX=7955 GN=si:dkey-46n18.7 PE=1 SV=1
5	AFDB:Q9UKL0	0.290	0.296	4.304E-31	485	0.495	0.505	Q9UKL0.pdb.gz	RCOR1_HUMAN REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2
6	AFDB:Q59E36	0.240	0.209	4.277E-23	590	0.325	0.273	Q59E36.pdb.gz	RCOR_DROME REST corepressor OS=Drosophila melanogaster OX=7227 GN=CoRest PE=1 SV=2
7	PDB:4czzB	0.262	0.942	5.100E-16	133	0.267	0.992	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
8	PDB:5l3cB	0.262	0.935	2.232E-12	134	0.200	0.739	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
9	AFDB:Q7Z3K6	0.186	0.170	3.769E-5	550	0.117	0.105	Q7Z3K6.pdb.gz	MIER3_HUMAN Mesoderm induction early response protein 3 OS=Homo sapiens OX=9606 GN=MIER3 PE=1 SV=2
10	PDB:7aoaD	0.194	0.262	4.491E-5	343	0.097	0.140	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
11	AFDB:A0A0R4IQL7	0.107	0.116	7.474E-3	450	0.145	0.160	A0A0R4IQL7.pdb.gz	A0A0R4IQL7_DANRE Paired box 6b OS=Danio rerio OX=7955 GN=Pax6.2 PE=3 SV=1
12	AFDB:Q5AAF4	0.075	0.038	2.875E-2	1485	0.158	0.053	Q5AAF4.pdb.gz	BNR1_CANAL Formin BNR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BNR1 PE=1 SV=1
13	AFDB:O75113	0.083	0.053	3.023E-2	896	0.119	0.066	O75113.pdb.gz	N4BP1_HUMAN NEDD4-binding protein 1 OS=Homo sapiens OX=9606 GN=N4BP1 PE=1 SV=4
14	PDB:5lj5O	0.088	0.126	3.403E-1	283	0.091	0.159	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
15	PDB:6id0L	0.092	0.095	4.825E-1	475	0.105	0.109	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
16	PDB:5gm6c	0.085	0.095	6.843E-1	415	0.087	0.104	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:6iczL	0.106	0.112	7.193E-1	454	0.103	0.112	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
18	PDB:6f44W	0.112	0.301	7.948E-1	172	0.059	0.169	6f44W.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
19	PDB:6k15D	0.083	0.133	9.231E-1	305	0.046	0.075	6k15D.pdb.gz	Structure of the RSC complex bound to the nucleosome.
20	PDB:6tdaL	0.084	0.070	9.231E-1	596	0.032	0.027	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PGA0	0.0	590	451	0.560	0.614	RCOR3_MOUSE REST corepressor 3 OS=Mus musculus OX=10090 GN=Rcor3 PE=1 SV=2
2	Q9P2K3	0.0	1027	495	1.000	1.000	RCOR3_HUMAN REST corepressor 3 OS=Homo sapiens OX=9606 GN=RCOR3 PE=1 SV=2
3	Q5FWT8	1.47e-176	508	523	0.566	0.535	RCOR2_RAT REST corepressor 2 OS=Rattus norvegicus OX=10116 GN=Rcor2 PE=1 SV=1
4	Q8IZ40	2.30e-176	507	523	0.568	0.537	RCOR2_HUMAN REST corepressor 2 OS=Homo sapiens OX=9606 GN=RCOR2 PE=1 SV=2
5	Q8C796	6.06e-176	506	523	0.564	0.533	RCOR2_MOUSE REST corepressor 2 OS=Mus musculus OX=10090 GN=Rcor2 PE=1 SV=1
6	Q8CFE3	4.98e-168	484	480	0.491	0.506	RCOR1_MOUSE REST corepressor 1 OS=Mus musculus OX=10090 GN=Rcor1 PE=1 SV=3
7	A1L228	1.87e-165	477	458	0.495	0.535	A1L228_DANRE REST corepressor 1 OS=Danio rerio OX=7955 GN=si:dkey-46n18.7 PE=1 SV=1
8	Q9UKL0	2.41e-165	478	485	0.499	0.509	RCOR1_HUMAN REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2
9	Q6NRZ0	8.89e-163	472	503	0.549	0.541	RCOR2_XENLA REST corepressor 2 OS=Xenopus laevis OX=8355 GN=rcor2 PE=2 SV=1
10	Q59E36	1.06e-67	229	590	0.204	0.171	RCOR_DROME REST corepressor OS=Drosophila melanogaster OX=7227 GN=CoRest PE=1 SV=2
11	A0A0B4KG70	9.01e-14	76.3	922	0.099	0.053	A0A0B4KG70_DROME Metastasis associated 1-like, isoform D OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=1
12	Q9VNF6	9.54e-14	76.3	880	0.099	0.056	Q9VNF6_DROME Metastasis associated 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=2
13	Q9VNF7	9.68e-14	76.3	844	0.099	0.058	Q9VNF7_DROME Metastasis associated 1-like, isoform B OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=2
14	Q9U6X3	1.06e-13	76.3	841	0.099	0.058	Q9U6X3_DROME LD04853p (Fragment) OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=2 SV=1
15	B7Z0T5	1.18e-13	75.9	853	0.099	0.057	B7Z0T5_DROME Metastasis associated 1-like, isoform C OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=1
16	Q6AWS2	1.23e-13	75.9	857	0.099	0.057	Q6AWS2_DROME SD15071p OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=2 SV=1
17	F7F888	4.95e-12	70.9	670	0.095	0.070	F7F888_RAT Metastasis associated 1 family, member 2 OS=Rattus norvegicus OX=10116 GN=Mta2 PE=1 SV=1
18	C9J7T7	1.35e-11	69.7	2062	0.055	0.013	C9J7T7_HUMAN Nuclear receptor corepressor 2 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3
19	A0A384DVL6	1.36e-11	69.7	2079	0.055	0.013	A0A384DVL6_HUMAN Nuclear receptor corepressor 2 (Fragment) OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=1
20	Q9H0D2	1.61e-11	69.3	1346	0.095	0.035	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01448 ELM2	1.5e-09	49.8	ELM2 domain
2	PF00249 Myb_DNA-binding	4.1e-15	67.0	Myb-like DNA-binding domain
3	PF13921 Myb_DNA-bind_6	0.042	25.4	Myb-like DNA-binding domain
4	PF15963 Myb_DNA-bind_7	1.3e-05	36.3	Myb DNA-binding like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000413929

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383042	0.994	Lysine-specific histone demethylase 1A
2	9606.ENSP00000328269	0.935	High mobility group 20B
3	9606.ENSP00000362649	0.894	Histone deacetylase 1
4	9606.ENSP00000430432	0.888	Histone deacetylase 2
5	9606.ENSP00000398824	0.861	PHD finger protein 21A
6	9606.ENSP00000244050	0.836	Zinc finger protein SNAI1
7	9606.ENSP00000253458	0.817	Genetic suppressor element 1
8	9606.ENSP00000371133	0.804	High mobility group protein 20A
9	9606.ENSP00000344782	0.641	Zinc finger protein Gfi-1b
10	9606.ENSP00000311816	0.640	RE1-silencing transcription factor
11	9606.ENSP00000359357	0.637	Zinc finger protein Gfi-1
12	9606.ENSP00000429562	0.637	Protein unc-13 homolog A
13	9606.ENSP00000360526	0.630	Zinc finger protein 217
14	9606.ENSP00000455711	0.627	Transcriptional repressor scratch 1
15	9606.ENSP00000378402	0.609	Paired amphipathic helix protein Sin3a
16	9606.ENSP00000355979	0.608	SERTA domain containing 4
17	9606.ENSP00000324403	0.594	PHD finger protein 21B
18	9606.ENSP00000344479	0.594	Nuclear receptor subfamily 4 group A member 2
19	9606.ENSP00000164024	0.588	Cadherin EGF LAG seven-pass G-type receptor 3
20	9606.ENSP00000297792	0.587	Lysine-specific histone demethylase 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.922	transcription regulator activity
GO:0003712	0.532	transcription coregulator activity
GO:0008134	0.318	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0031323	0.976	regulation of cellular metabolic process
GO:0080090	0.966	regulation of primary metabolic process
GO:0060255	0.963	regulation of macromolecule metabolic process
GO:0031326	0.956	regulation of cellular biosynthetic process
GO:0048519	0.939	negative regulation of biological process
GO:0051171	0.926	regulation of nitrogen compound metabolic process
GO:0009987	0.901	cellular process
GO:0009892	0.863	negative regulation of metabolic process
GO:0048523	0.855	negative regulation of cellular process
GO:0019219	0.837	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.835	regulation of gene expression
GO:0048856	0.833	anatomical structure development
GO:0010556	0.827	regulation of macromolecule biosynthetic process
GO:0051252	0.824	regulation of RNA metabolic process
GO:0010605	0.813	negative regulation of macromolecule metabolic process
GO:0031324	0.794	negative regulation of cellular metabolic process
GO:2001141	0.775	regulation of RNA biosynthetic process
GO:1903506	0.774	regulation of nucleic acid-templated transcription
GO:0006355	0.762	regulation of DNA-templated transcription
GO:0009890	0.749	negative regulation of biosynthetic process
GO:0051172	0.746	negative regulation of nitrogen compound metabolic process
GO:0045934	0.743	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.728	negative regulation of cellular biosynthetic process
GO:0010558	0.718	negative regulation of macromolecule biosynthetic process
GO:0051253	0.717	negative regulation of RNA metabolic process
GO:1903507	0.700	negative regulation of nucleic acid-templated transcription
GO:0045892	0.676	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.985	cytoplasm
GO:0005829	0.983	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]