StarFunc result for job id Q9P2K8

User Input

>input (1649 residues)
MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLY
PQGLTGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNESVNLLKSRLEELAKKHCGE
VMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQ
RRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHR
ANSSGRSRRERQYSVCNSEDSPGSCEILYFNMGSPDQLMVHKGKCIGSDEQLGKLVYNAL
ETATGGFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTETEFNSLVKLSHPNVVR
YLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDYLHSNS
VVHKVLSASNVLVDAEGTVKITDYSISKRLADICKEDVFEQTRVRFSDNALPYKTGKKGD
VWRLGLLLLSLSQGQECGEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKMPLVEQSPEDSEGQDYVETVIPSNRLPSAAFFSETQRQFSRYFIEFEELQLLGKGA
FGAVIKVQNKLDGCCYAVKRIPINPASRQFRRIKGEVTLLSRLHHENIVRYYNAWIERHE
RPAGPGTPPPDSGPLAKDDRAARGQPASDTDGLDSVEAAAPPPILSSSVEWSTSGERSAS
ARFPATGPGSSDDEDDDEDEHGGVFSQSFLPASDSESDIIFDNEDENSKSQNQDEDCNEK
NGCHESEPSVTTEAVHYLYIQMEYCEKSTLRDTIDQGLYRDTVRLWRLFREILDGLAYIH
EKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFSADSKQDDQTGDLIKSDPSGHLTG
MVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTSP
KFPEDFDDGEHAKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHTLT
NVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGA
VQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRIPFARYVARNNILNLKRYCIE
RVFRPRKLDRFHPKELLECAFDIVTSTTNSFLPTAEIIYTIYEIIQEFPALQERNYSIYL
NHTMLLKAILLHCGIPEDKLSQVYIILYDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKF
IEQKGDLQDLMPTINSLIKQKTGIAQLVKYGLKDLEEVVGLLKKLGIKLQVLINLGLVYK
VQQHNGIIFQFVAFIKRRQRAVPEILAAGGRYDLLIPQFRGPQALGPVPTAIGVSIAIDK
ISAAVLNMEESVTISSCDLLVVSVGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQ
EYCRHHEITYVALVSDKEGSHVKVKSFEKERQTEKRVLETELVDHVLQKLRTKVTDERNG
REASDNLAVQNLKGSFSNASGLFEIHGATVVPIVSVLAPEKLSASTRRRYETQVQTRLQT
SLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVC
DEIYNIKVEKKVSVLFLYSYRDDYYRILF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A7V9	0.580	0.580	0.000	1649	0.905	0.905	D4A7V9.pdb.gz	E2AK4_RAT eIF-2-alpha kinase GCN2 OS=Rattus norvegicus OX=10116 GN=Eif2ak4 PE=3 SV=2
2	PDB:4phcA	0.236	0.796	2.524E-28	444	0.069	0.257	4phcA.pdb.gz	Comparison of histidine recognition in human and trypanosomatid histidyl-tRNA synthetases.
3	PDB:7qwkH	0.147	0.909	1.125E-27	259	0.152	0.965	7qwkH.pdb.gz	The structure of human GCN2 reveals a parallel, back-to-back kinase dimer with a plastic DFG activation loop motif.
4	PDB:7qwkE	0.142	0.943	1.654E-27	241	0.144	0.983	7qwkE.pdb.gz	The structure of human GCN2 reveals a parallel, back-to-back kinase dimer with a plastic DFG activation loop motif.
5	PDB:4g85A	0.227	0.790	2.710E-26	427	0.070	0.269	4g85A.pdb.gz
6	PDB:6o76B	0.214	0.705	3.489E-25	451	0.073	0.268	6o76B.pdb.gz
7	AFDB:Q9NZJ5	0.158	0.227	5.997E-24	1116	0.126	0.186	Q9NZJ5.pdb.gz	E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens OX=9606 GN=EIF2AK3 PE=1 SV=3
8	AFDB:Q9BQI3	0.161	0.399	1.930E-22	630	0.087	0.227	Q9BQI3.pdb.gz	E2AK1_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Homo sapiens OX=9606 GN=EIF2AK1 PE=1 SV=2
9	AFDB:Q63185	0.156	0.395	1.610E-21	620	0.083	0.221	Q63185.pdb.gz	E2AK1_RAT Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Rattus norvegicus OX=10116 GN=Eif2ak1 PE=1 SV=2
10	PDB:4x5oB	0.186	0.796	4.024E-21	350	0.058	0.271	4x5oB.pdb.gz
11	AFDB:Q0H740	0.152	0.470	2.904E-20	513	0.094	0.302	Q0H740.pdb.gz	Q0H740_SALSA DsRNA activated Z-DNA binding protein kinase OS=Salmo salar OX=8030 GN=PKZ PE=2 SV=1
12	AFDB:P33279	0.155	0.384	3.924E-19	626	0.082	0.217	P33279.pdb.gz	E2AK1_RABIT Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Oryctolagus cuniculus OX=9986 GN=EIF2AK1 PE=1 SV=1
13	AFDB:Q9UTE5	0.157	0.382	6.997E-19	639	0.089	0.230	Q9UTE5.pdb.gz	E2AK2_SCHPO Eukaryotic translation initiation factor 2-alpha kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hri2 PE=1 SV=1
14	PDB:3hriA	0.199	0.722	4.871E-17	401	0.048	0.197	3hriA.pdb.gz
15	PDB:1kmmC	0.188	0.710	8.278E-17	387	0.041	0.176	1kmmC.pdb.gz	The first step of aminoacylation at the atomic level in histidyl-tRNA synthetase.
16	AFDB:Q54I36	0.137	0.167	1.160E-16	1338	0.099	0.122	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
17	PDB:1httA	0.179	0.725	3.193E-16	366	0.039	0.175	1httA.pdb.gz	Crystal structure of histidyl-tRNA synthetase from Escherichia coli complexed with histidyl-adenylate.
18	PDB:3hriF	0.187	0.749	1.567E-15	370	0.044	0.195	3hriF.pdb.gz
19	AFDB:Q7ZVS3	0.126	0.215	3.071E-11	940	0.058	0.101	Q7ZVS3.pdb.gz	PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio OX=7955 GN=plk4 PE=2 SV=2
20	AFDB:F1LP90	0.130	0.158	3.223E-11	1336	0.064	0.079	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHX7	0.0	704	1591	0.329	0.341	A0A0B4KHX7_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Gcn2 PE=1 SV=1
2	D4A7V9	0.0	3008	1649	0.898	0.898	E2AK4_RAT eIF-2-alpha kinase GCN2 OS=Rattus norvegicus OX=10116 GN=Eif2ak4 PE=3 SV=2
3	O01712	0.0	704	1589	0.329	0.342	O01712_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Gcn2 PE=2 SV=1
4	O61651	0.0	703	1589	0.329	0.342	O61651_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Gcn2 PE=2 SV=1
5	Q9P2K8	0.0	3417	1649	1.000	1.000	E2AK4_HUMAN eIF-2-alpha kinase GCN2 OS=Homo sapiens OX=9606 GN=EIF2AK4 PE=1 SV=3
6	Q9QZ05	0.0	3008	1648	0.897	0.897	E2AK4_MOUSE eIF-2-alpha kinase GCN2 OS=Mus musculus OX=10090 GN=Eif2ak4 PE=1 SV=2
7	Q9V9X8	0.0	703	1589	0.329	0.342	Q9V9X8_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Gcn2 PE=1 SV=1
8	Q7YU14	7.32e-169	548	1312	0.246	0.309	Q7YU14_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Gcn2 PE=2 SV=1
9	Q4WU06	2.16e-133	456	1592	0.244	0.253	Q4WU06_ASPFU non-specific serine/threonine protein kinase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G06750 PE=4 SV=1
10	Q9HGN1	8.63e-122	422	1576	0.220	0.230	GCN2_SCHPO eIF-2-alpha kinase GCN2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn2 PE=2 SV=2
11	P15442	3.12e-95	343	1659	0.202	0.201	GCN2_YEAST eIF-2-alpha kinase GCN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN2 PE=1 SV=3
12	Q550L8	1.51e-91	329	1358	0.153	0.186	IFKB_DICDI Probable serine/threonine-protein kinase ifkB OS=Dictyostelium discoideum OX=44689 GN=ifkB PE=2 SV=1
13	Q558U1	1.38e-90	330	2258	0.152	0.111	IFKA_DICDI Probable serine/threonine-protein kinase ifkA OS=Dictyostelium discoideum OX=44689 GN=ifkA PE=2 SV=1
14	A0A1D8PQT9	1.85e-87	319	1764	0.198	0.185	A0A1D8PQT9_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GCN2 PE=4 SV=1
15	D0Z5N4	8.46e-83	304	1699	0.213	0.207	E2AKB_CAEEL Eukaryotic translation initiation factor 2-alpha kinase gcn-2 OS=Caenorhabditis elegans OX=6239 GN=gcn-2 PE=1 SV=2
16	F4J8A5	2.23e-61	234	1265	0.125	0.163	F4J8A5_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=GCN2 PE=1 SV=1
17	B8JI14	1.81e-45	182	1099	0.089	0.134	B8JI14_DANRE Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Danio rerio OX=7955 GN=eif2ak3 PE=1 SV=1
18	Q9Z1Z1	1.93e-45	182	1108	0.091	0.135	E2AK3_RAT Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Rattus norvegicus OX=10116 GN=Eif2ak3 PE=1 SV=1
19	Q9BQI3	2.23e-42	168	630	0.093	0.244	E2AK1_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Homo sapiens OX=9606 GN=EIF2AK1 PE=1 SV=2
20	Q0H740	9.56e-42	164	513	0.085	0.273	Q0H740_SALSA DsRNA activated Z-DNA binding protein kinase OS=Salmo salar OX=8030 GN=PKZ PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	51	14.4	ABC1 atypical kinase-like domain
2	PF12745 HGTP_anticodon2	1.1e-14	66.1	Anticodon binding domain of tRNAs
3	PF14531 Kinase-like	0.12	23.3	Kinase-like
4	PF00069 Pkinase	2.6e-77	271.4	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	3.8e-43	159.2	Protein tyrosine and serine/threonine kinase
6	PF05773 RWD	7.6e-18	76.3	RWD domain
7	PF13393 tRNA-synt_His	6.1e-09	47.2	Histidyl-tRNA synthetase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263791

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256383	0.998	Eukaryotic translation initiation factor 2 subunit 1
2	9606.ENSP00000300648	0.997	eIF-2-alpha kinase activator GCN1
3	9606.ENSP00000364119	0.978	Eukaryotic translation initiation factor 2 subunit 2
4	9606.ENSP00000253039	0.973	Eukaryotic translation initiation factor 2 subunit 3
5	9606.ENSP00000339063	0.910	Elongation factor 1-alpha 1
6	9606.ENSP00000416250	0.898	Translation initiation factor eIF-2B subunit alpha
7	9606.ENSP00000273783	0.868	Translation initiation factor eIF-2B subunit epsilon
8	9606.ENSP00000266126	0.864	Translation initiation factor eIF-2B subunit beta
9	9606.ENSP00000354558	0.861	Serine/threonine-protein kinase mTOR
10	9606.ENSP00000355890	0.857	Bifunctional glutamate/proline--tRNA ligase
11	9606.ENSP00000336790	0.849	Cyclic AMP-dependent transcription factor ATF-4
12	9606.ENSP00000284202	0.841	Protein IMPACT
13	9606.ENSP00000380252	0.841	Nuclear factor erythroid 2-related factor 2
14	9606.ENSP00000425561	0.841	Eukaryotic translation initiation factor 4E
15	9606.ENSP00000394869	0.825	Translation initiation factor eIF-2B subunit delta
16	9606.ENSP00000325448	0.820	Lysine--tRNA ligase
17	9606.ENSP00000360869	0.809	Interferon-induced protein with tetratricopeptide repeats 1
18	9606.ENSP00000360874	0.804	Interferon induced protein with tetratricopeptide repeats 1B
19	9606.ENSP00000362576	0.794	Tyrosine--tRNA ligase, cytoplasmic
20	9606.ENSP00000307940	0.792	Elongation factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004694	0.998	eukaryotic translation initiation factor 2alpha kinase activity
GO:0097159	0.970	organic cyclic compound binding
GO:1901363	0.969	heterocyclic compound binding
GO:0003676	0.883	nucleic acid binding
GO:0003723	0.845	RNA binding
GO:0000049	0.364	tRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.995	cellular process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0043170	0.990	macromolecule metabolic process
GO:1901564	0.988	organonitrogen compound metabolic process
GO:1990928	0.988	response to amino acid starvation
GO:0006446	0.986	regulation of translational initiation
GO:0043555	0.984	regulation of translation in response to stress
GO:0019538	0.981	protein metabolic process
GO:0034198	0.976	cellular response to amino acid starvation
GO:0048522	0.917	positive regulation of cellular process
GO:0006796	0.914	phosphate-containing compound metabolic process
GO:0031325	0.911	positive regulation of cellular metabolic process
GO:0043412	0.891	macromolecule modification
GO:0016310	0.891	phosphorylation
GO:0036211	0.879	protein modification process
GO:0006468	0.834	protein phosphorylation
GO:0051247	0.807	positive regulation of protein metabolic process
GO:0034976	0.492	response to endoplasmic reticulum stress
GO:0009628	0.395	response to abiotic stimulus
GO:0048519	0.378	negative regulation of biological process
GO:0048583	0.373	regulation of response to stimulus
GO:0023052	0.305	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.995	protein-containing complex
GO:0005622	0.990	intracellular anatomical structure
GO:0005737	0.978	cytoplasm
GO:0005829	0.949	cytosol
GO:0070013	0.942	intracellular organelle lumen
GO:0005844	0.843	polysome
GO:0043227	0.750	membrane-bounded organelle
GO:0043231	0.733	intracellular membrane-bounded organelle
GO:0005634	0.514	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.998	Phosphotransferases with an alcohol group as acceptor.

[back to server]