StarFunc result for job id Q9P2K9

User Input

>input (1392 residues)
MDTEDDPLLQDVWLEEEQEEEEATGETFLGAQKPGPQPGAGGQCCWRHWPLASRPPASGF
WSTLGWAFTNPCCAGLVLFLGCSIPMALSAFMFLYYPPLDIDISYNAFEIRNHEASQRFD
ALTLALKSQFGSWGRNRRDLADFTSETLQRLISEQLQQLHLGNRSRQASRAPRVIPAASL
GGPGPYRDTSAAQKPTANRSGRLRRETPPLEDLAANQSEDPRNQRLSKNGRYQPSIPPHA
AVAANQSRARRGASRWDYSRAYVSANTQTHAHWRIELIFLARGDAERNIFTSERLVTIHE
IERKIMDHPGFREFCWKPHEVLKDLPLGSYSYCSPPSSLMTYFFPTERGGKIYYDGMGQD
LADIRGSLELAMTHPEFYWYVDEGLSADNLKSSLLRSEILFGAPLPNYYSVDDRWEEQRA
KFQSFVVTYVAMLAKQSTSKVQVLYGGTDLFDYEVRRTFNNDMLLAFISSSCIAALVYIL
TSCSVFLSFFGIASIGLSCLVALFLYHVVFGIQYLGILNGVAAFVIVGIGVDDVFVFINT
YRQATHLEDPQLRMIHTVQTAGKATFFTSLTTAAAYAANVFSQIPAVHDFGLFMSLIVSC
CWLAVLVTMPAALGLWSLYLAPLESSCQTSCHQNCSRKTSLHFPGDVFAAPEQVGGSPAQ
GPIPYLDDDIPLLEVEEEPVSLELGDVSLVSVSPEGLQPASNTGSRGHLIVQLQELLHHW
VLWSAVKSRWVIVGLFVSILILSLVFASRLRPASRAPLLFRPDTNIQVLLDLKYNLSAEG
ISCITCSGLFQEKPHSLQNNIRTSLEKKRRGSGVPWASRPEATLQDFPGTVYISKVKSQG
HPAVYRLSLNASLPAPWQAVSPGDGEVPSFQVYRAPFGNFTKKLTACMSTVGLLQAASPS
RKWMLTTLACDAKRGWKFDFSFYVATKEQQHTRKLYFAQSHKPPFHGRVCMAPPGCLLSS
SPDGPTKGFFFVPSEKVPKARLSATFGFNPCVNTGCGKPAVRPLVDTGAMVFVVFGIIGV
NRTRQVDNHVIGDPGSVVYDSSFDLFKEIGHLCHLCKAIAANSELVKPGGAQCLPSGYSI
SSFLQMLHPECKELPEPNLLPGQLSHGAVGVREGRVQWISMAFESTTYKGKSSFQTYSDY
LRWESFLQQQLQALPEGSVLRRGFQTCEHWKQIFMEIVGVQSALCGLVLSLLICVAAVAV
FTTHILLLLPVLLSILGIVCLVVTIMYWSGWEMGAVEAISLSILVGSSVDYCVHLVEGYL
LAGENLPPHQAEDARTQRQWRTLEAVRHVGVAIVSSALTTVIATVPLFFCIIAPFAKFGK
IVALNTGVSILYTLTVSTALLGIMAPSSFTRTRTSFLKALGAVLLAGALGLGACLVLLQS
GYKIPLPAGASL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B9U3F2	0.751	0.780	0.000	1338	0.783	0.815	B9U3F2.pdb.gz	DISP3_CHICK Protein dispatched homolog 3 OS=Gallus gallus OX=9031 GN=DISP3 PE=1 SV=1
2	AFDB:Q9P2K9	1.000	1.000	0.000	1392	1.000	1.000	Q9P2K9.pdb.gz	DISP3_HUMAN Protein dispatched homolog 3 OS=Homo sapiens OX=9606 GN=DISP3 PE=2 SV=2
3	AFDB:A7MBM2	0.457	0.454	4.364E-24	1401	0.157	0.156	A7MBM2.pdb.gz	DISP2_HUMAN Protein dispatched homolog 2 OS=Homo sapiens OX=9606 GN=DISP2 PE=2 SV=2
4	PDB:6tbuA	0.397	0.618	1.479E-21	842	0.111	0.184	6tbuA.pdb.gz	Cryo-EM structure of the Hedgehog release protein Dispatched.
5	AFDB:Q0EEE2	0.411	0.600	3.122E-18	906	0.103	0.159	Q0EEE2.pdb.gz	PTHD3_MOUSE Patched domain-containing protein 3 OS=Mus musculus OX=10090 GN=Ptchd3 PE=1 SV=1
6	AFDB:O44978	0.355	0.569	2.850E-17	820	0.087	0.148	O44978.pdb.gz	O44978_CAEEL SSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ptr-11 PE=1 SV=1
7	AFDB:Q98864	0.372	0.418	3.525E-17	1220	0.103	0.118	Q98864.pdb.gz	PTC1_DANRE Protein patched homolog 1 OS=Danio rerio OX=7955 GN=ptch1 PE=2 SV=1
8	AFDB:Q6T3U4	0.368	0.382	7.263E-17	1333	0.111	0.116	Q6T3U4.pdb.gz	NPCL1_MOUSE NPC1-like intracellular cholesterol transporter 1 OS=Mus musculus OX=10090 GN=Npc1l1 PE=1 SV=1
9	AFDB:Q5BBG1	0.402	0.436	1.317E-16	1271	0.093	0.102	Q5BBG1.pdb.gz	Q5BBG1_EMENI SSD domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02119 PE=3 SV=1
10	PDB:7e2iD	0.384	0.566	1.434E-16	907	0.114	0.174	7e2iD.pdb.gz	Structural insights into proteolytic activation of the human Dispatched1 transporter for Hedgehog morphogen release.
11	AFDB:H1UBK7	0.372	0.559	8.200E-16	888	0.095	0.149	H1UBK7.pdb.gz	H1UBK7_CAEEL SSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ptr-22 PE=4 SV=1
12	PDB:6v3fA	0.371	0.412	2.477E-15	1234	0.118	0.133	6v3fA.pdb.gz	Cryo-EM structures of NPC1L1 reveal mechanisms of cholesterol transport and ezetimibe inhibition
13	AFDB:B6VQ56	0.337	0.490	3.882E-12	892	0.073	0.114	B6VQ56.pdb.gz	B6VQ56_CAEEL SSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ptr-24 PE=1 SV=1
14	PDB:7n6bA	0.339	0.581	6.747E-12	757	0.076	0.140	7n6bA.pdb.gz	Structures of the mycobacterial membrane protein MmpL3 reveal its mechanism of lipid transport.
15	PDB:3w9iF	0.266	0.349	1.269E-10	1033	0.091	0.123	3w9iF.pdb.gz
16	PDB:3nogA	0.262	0.345	1.442E-10	1012	0.082	0.113	3nogA.pdb.gz
17	PDB:6dmyA	0.343	0.464	1.783E-10	992	0.098	0.138	6dmyA.pdb.gz	Structural basis for the recognition of Sonic Hedgehog by human Patched1.
18	PDB:2v50D	0.269	0.361	6.664E-10	998	0.087	0.121	2v50D.pdb.gz
19	PDB:4zivB	0.275	0.353	7.899E-10	1046	0.091	0.121	4zivB.pdb.gz
20	PDB:4dnrA	0.257	0.335	4.516E-9	1031	0.083	0.113	4dnrA.pdb.gz	Crystal structures of the pre-extrusion and extrusion states of the CusBA adaptor-transporter complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B9U3F2	0.0	2128	1338	0.787	0.819	DISP3_CHICK Protein dispatched homolog 3 OS=Gallus gallus OX=9031 GN=DISP3 PE=1 SV=1
2	Q9P2K9	0.0	2866	1392	1.000	1.000	DISP3_HUMAN Protein dispatched homolog 3 OS=Homo sapiens OX=9606 GN=DISP3 PE=2 SV=2
3	Q6R5J2	6.60e-17	89.4	1464	0.041	0.039	DISP1_DANRE Protein dispatched homolog 1 OS=Danio rerio OX=7955 GN=disp1 PE=2 SV=1
4	Q96F81	1.44e-15	85.1	1524	0.039	0.035	DISP1_HUMAN Protein dispatched homolog 1 OS=Homo sapiens OX=9606 GN=DISP1 PE=1 SV=3
5	Q3TDN0	2.00e-15	84.7	1521	0.038	0.035	DISP1_MOUSE Protein dispatched homolog 1 OS=Mus musculus OX=10090 GN=Disp1 PE=1 SV=2
6	Q9VNJ5	9.46e-13	75.9	1218	0.040	0.046	DISP_DROME Protein dispatched OS=Drosophila melanogaster OX=7227 GN=disp PE=1 SV=1
7	Q9XWL9	1.02e-10	68.9	895	0.046	0.072	PTR18_CAEEL Patched-related protein 18 OS=Caenorhabditis elegans OX=6239 GN=ptr-18 PE=1 SV=3
8	Q9Y6C5	1.07e-10	68.9	1203	0.045	0.052	PTC2_HUMAN Protein patched homolog 2 OS=Homo sapiens OX=9606 GN=PTCH2 PE=1 SV=2
9	Q8CIP5	1.47e-10	68.6	1345	0.032	0.033	DISP2_MOUSE Protein dispatched homolog 2 OS=Mus musculus OX=10090 GN=Disp2 PE=1 SV=1
10	Q7TMD4	7.04e-10	66.2	1277	0.047	0.051	Q7TMD4_MOUSE Niemann Pick type C1 OS=Mus musculus OX=10090 GN=Npc1 PE=2 SV=1
11	O35604	7.10e-10	66.2	1277	0.047	0.051	NPC1_MOUSE NPC intracellular cholesterol transporter 1 OS=Mus musculus OX=10090 GN=Npc1 PE=1 SV=2
12	O35595	4.86e-09	63.5	1182	0.045	0.053	PTC2_MOUSE Protein patched homolog 2 OS=Mus musculus OX=10090 GN=Ptch2 PE=2 SV=2
13	H1UBK6	8.03e-09	62.8	680	0.028	0.057	H1UBK6_CAEEL SSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ptr-22 PE=4 SV=1
14	H1UBK7	8.92e-09	62.8	888	0.028	0.044	H1UBK7_CAEEL SSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ptr-22 PE=4 SV=1
15	G3V7K5	2.86e-08	61.2	1278	0.042	0.046	G3V7K5_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=3 SV=1
16	A0A8I6GB30	3.05e-08	61.2	1265	0.042	0.047	A0A8I6GB30_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=1 SV=1
17	A0A8I6AL97	3.20e-08	60.8	1259	0.042	0.047	A0A8I6AL97_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=1 SV=1
18	Q59GR1	9.35e-08	59.3	1289	0.042	0.045	Q59GR1_HUMAN Niemann-Pick disease, type C1 variant (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
19	O15118	1.10e-07	59.3	1278	0.042	0.045	NPC1_HUMAN NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1 PE=1 SV=2
20	B4DIP7	1.12e-07	58.9	776	0.042	0.075	B4DIP7_HUMAN cDNA FLJ57114, highly similar to Niemann-Pick C1 protein OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03176 MMPL	4.3e-13	60.5	MMPL family
2	PF02460 Patched	7.6e-17	72.4	Patched family
3	PF12349 Sterol-sensing	2.2e-10	52.0	Sterol-sensing domain of SREBP cleavage-activation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294484

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366006	0.910	UbiA prenyltransferase domain-containing protein 1
2	9606.ENSP00000346240	0.828	F-box only protein 2
3	9606.ENSP00000368666	0.778	Patched domain-containing protein 1
4	9606.ENSP00000341914	0.728	Patched domain-containing protein 4
5	9606.ENSP00000266991	0.721	Desert hedgehog protein
6	9606.ENSP00000256404	0.718	Phosphatidylethanolamine-binding protein 4
7	9606.ENSP00000284719	0.691	Obg-like ATPase 1
8	9606.ENSP00000297261	0.684	Sonic hedgehog protein
9	9606.ENSP00000295731	0.680	Indian hedgehog protein
10	9606.ENSP00000276416	0.646	Bridging integrator 3
11	9606.ENSP00000233557	0.637	Nuclear receptor-binding protein
12	9606.ENSP00000365961	0.600	F-box only protein 44
13	9606.ENSP00000348429	0.593	Long-chain-fatty-acid--CoA ligase 5
14	9606.ENSP00000427926	0.572	Rho-related BTB domain-containing protein 2
15	9606.ENSP00000365944	0.556	F-box only protein 6
16	9606.ENSP00000338671	0.546	Rho-related BTB domain-containing protein 1
17	9606.ENSP00000318057	0.524	Early growth response protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005215	0.515	transporter activity
GO:0008289	0.398	lipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.982	regulation of cellular process
GO:0048518	0.895	positive regulation of biological process
GO:0019222	0.874	regulation of metabolic process
GO:0048522	0.772	positive regulation of cellular process
GO:0080090	0.742	regulation of primary metabolic process
GO:0042127	0.653	regulation of cell population proliferation
GO:2000177	0.635	regulation of neural precursor cell proliferation
GO:0019216	0.609	regulation of lipid metabolic process
GO:0009987	0.577	cellular process
GO:0045664	0.543	regulation of neuron differentiation
GO:0048519	0.413	negative regulation of biological process
GO:0048523	0.404	negative regulation of cellular process
GO:0050896	0.338	response to stimulus
GO:0008284	0.304	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.995	endomembrane system
GO:0043229	0.988	intracellular organelle
GO:0043227	0.983	membrane-bounded organelle
GO:0016020	0.981	membrane
GO:0043231	0.972	intracellular membrane-bounded organelle
GO:0005634	0.930	nucleus
GO:0005829	0.320	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]