StarFunc result for job id Q9P2L0

User Input

>input (1181 residues)
MFFYLSKKISIPNNVKLQCVSWNKEQGFIACGGEDGLLKVLKLETQTDDAKLRGLAAPSN
LSMNQTLEGHSGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS
MSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLSHVTWSADSKVLLFGMANGEI
HIYDNQGNFMIKMKLSCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAVCFDNGRCQIMR
HENDQNPVLIDTGMYVVGIQWNHMGSVLAVAGFQKAAMQDKDVNIVQFYTPFGEHLGTLK
VPGKEISALSWEGGGLKIALAVDSFIYFANIRPNYKWGYCSNTVVYAYTRPDRPEYCVVF
WDTKNNEKYVKYVKGLISITTCGDFCILATKADENHPQEENEMETFGATFVLVLCNSIGT
PLDPKYIDIVPLFVAMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIY
HVDDTPSGSMDGVLDYSKTIQGTRDPICAITASDKILIVGRESGTIQRYSLPNVGLIQKY
SLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLKLERRDVWDMK
WAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPNK
DYLINFEIRSLRDSRALIEKVGIKDASQFIEDNPHPRLWRLLAEAALQKLDLYTAEQAFV
RCKDYQGIKFVKRLGKLLSESMKQAEVVGYFGRFEEAERTYLEMDRRDLAIGLRLKLGDW
FRVLQLLKTGSGDADDSLLEQANNAIGDYFADRQKWLNAVQYYVQGRNQERLAECYYMLE
DYEGLENLAISLPENHKLLPEIAQMFVRVGMCEQAVTAFLKCSQPKAAVDTCVHLNQWNK
AVELAKNHSMKEIGSLLARYASHLLEKNKTLDAIELYRKANYFFDAAKLMFKIADEEAKK
GSKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKGKSSEATSALAGLLEEEVLSTTDRFT
DNAWRGAEAYHFFILAQRQLYEGCVDTALKTALHLKDYEDIIPPVEIYSLLALCACASRA
FGTCSKAFIKLKSLETLSSEQKQQYEDLALEIFTKHTSKDNRKPELDSLMEGGEGKLPTC
VATGSPITEYQFWMCSVCKHGVLAQEISHYSFCPLCHSPVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7ZD88	0.760	0.747	0.000	1203	0.793	0.779	B7ZD88.pdb.gz	B7ZD88_DANRE WD repeat-containing protein 35 OS=Danio rerio OX=7955 GN=im:7159945 PE=1 SV=1
2	AFDB:Q8BND3	0.733	0.733	0.000	1181	0.922	0.922	Q8BND3.pdb.gz	WDR35_MOUSE WD repeat-containing protein 35 OS=Mus musculus OX=10090 GN=Wdr35 PE=1 SV=3
3	AFDB:Q9W097	0.805	0.791	0.000	1205	0.487	0.477	Q9W097.pdb.gz	Q9W097_DROME LD29485p OS=Drosophila melanogaster OX=7227 GN=Oseg4 PE=2 SV=1
4	AFDB:Q57ZX9	0.688	0.647	1.238E-97	1260	0.400	0.375	Q57ZX9.pdb.gz	Q57ZX9_TRYB2 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.80 PE=4 SV=1
5	AFDB:Q18859	0.645	0.615	1.415E-81	1246	0.314	0.298	Q18859.pdb.gz	Q18859_CAEEL Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ifta-1 PE=4 SV=4
6	AFDB:Q6NYH1	0.269	0.268	4.151E-40	1187	0.142	0.142	Q6NYH1.pdb.gz	IF122_DANRE Intraflagellar transport protein 122 homolog OS=Danio rerio OX=7955 GN=ift122 PE=2 SV=1
7	AFDB:Q38B65	0.274	0.262	5.996E-40	1242	0.137	0.130	Q38B65.pdb.gz	Q38B65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1660 PE=4 SV=1
8	AFDB:Q9HBG6	0.261	0.250	6.246E-40	1241	0.155	0.147	Q9HBG6.pdb.gz	IF122_HUMAN Intraflagellar transport protein 122 homolog OS=Homo sapiens OX=9606 GN=IFT122 PE=1 SV=2
9	AFDB:G5EFW7	0.264	0.262	2.950E-39	1192	0.163	0.162	G5EFW7.pdb.gz	IF122_CAEEL Intraflagellar transport protein 122 homolog OS=Caenorhabditis elegans OX=6239 GN=daf-10 PE=1 SV=1
10	AFDB:Q8T9D3	0.271	0.273	6.680E-39	1169	0.152	0.153	Q8T9D3.pdb.gz	Q8T9D3_DROME SD05642p OS=Drosophila melanogaster OX=7227 GN=Oseg1 PE=2 SV=1
11	PDB:6qk7A	0.218	0.221	1.522E-18	1161	0.127	0.129	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
12	PDB:5a1vK	0.263	0.273	1.651E-18	1126	0.112	0.117	5a1vK.pdb.gz
13	PDB:5nzrC	0.270	0.363	1.440E-17	843	0.080	0.112	5nzrC.pdb.gz
14	PDB:7mqaLQ	0.186	0.253	1.766E-17	830	0.097	0.137	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7mq8LT	0.184	0.241	1.008E-15	869	0.092	0.125	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7mq8LO	0.196	0.268	1.517E-15	848	0.091	0.126	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7mqaLO	0.205	0.290	2.192E-15	819	0.087	0.126	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7mq8LR	0.225	0.303	7.167E-15	773	0.078	0.119	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:6lqsB1	0.204	0.290	8.439E-15	806	0.072	0.105	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
20	PDB:5wyjBE	0.195	0.296	8.791E-15	753	0.080	0.125	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6N6J5	0.0	2283	1170	0.918	0.926	WDR35_RAT WD repeat-containing protein 35 OS=Rattus norvegicus OX=10116 GN=Wdr35 PE=1 SV=1
2	B7ZD88	0.0	2003	1203	0.794	0.780	B7ZD88_DANRE WD repeat-containing protein 35 OS=Danio rerio OX=7955 GN=im:7159945 PE=1 SV=1
3	Q57ZX9	0.0	882	1260	0.376	0.352	Q57ZX9_TRYB2 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.80 PE=4 SV=1
4	Q8BND3	0.0	2305	1181	0.923	0.923	WDR35_MOUSE WD repeat-containing protein 35 OS=Mus musculus OX=10090 GN=Wdr35 PE=1 SV=3
5	Q9P2L0	0.0	2464	1181	1.000	1.000	WDR35_HUMAN WD repeat-containing protein 35 OS=Homo sapiens OX=9606 GN=WDR35 PE=1 SV=3
6	Q9W097	0.0	1131	1205	0.494	0.485	Q9W097_DROME LD29485p OS=Drosophila melanogaster OX=7227 GN=Oseg4 PE=2 SV=1
7	Q18859	5.94e-148	479	1246	0.295	0.279	Q18859_CAEEL Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ifta-1 PE=4 SV=4
8	Q9NRJ4	7.57e-34	144	1543	0.089	0.068	TULP4_HUMAN Tubby-related protein 4 OS=Homo sapiens OX=9606 GN=TULP4 PE=1 SV=2
9	A0A0B4KI44	3.49e-32	139	1433	0.085	0.070	A0A0B4KI44_DROME Tusp, isoform F OS=Drosophila melanogaster OX=7227 GN=Tusp PE=3 SV=1
10	Q38B65	9.03e-11	68.9	1242	0.073	0.069	Q38B65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1660 PE=4 SV=1
11	G5EFW7	2.21e-08	61.2	1192	0.113	0.112	IF122_CAEEL Intraflagellar transport protein 122 homolog OS=Caenorhabditis elegans OX=6239 GN=daf-10 PE=1 SV=1
12	Q6NYH1	2.71e-08	60.8	1187	0.085	0.084	IF122_DANRE Intraflagellar transport protein 122 homolog OS=Danio rerio OX=7955 GN=ift122 PE=2 SV=1
13	Q9HBG6	1.14e-06	55.5	1241	0.085	0.081	IF122_HUMAN Intraflagellar transport protein 122 homolog OS=Homo sapiens OX=9606 GN=IFT122 PE=1 SV=2
14	Q6NWV3	1.24e-06	55.5	1182	0.083	0.083	IF122_MOUSE Intraflagellar transport protein 122 homolog OS=Mus musculus OX=10090 GN=Ift122 PE=1 SV=1
15	Q22830	8.19e-06	52.8	1737	0.058	0.040	OSM1_CAEEL Intraflagellar transport protein osm-1 OS=Caenorhabditis elegans OX=6239 GN=osm-1 PE=1 SV=4
16	O89053	1.37e-05	51.6	461	0.041	0.104	COR1A_MOUSE Coronin-1A OS=Mus musculus OX=10090 GN=Coro1a PE=1 SV=5
17	Q9VII8	1.50e-05	51.6	775	0.030	0.045	Q9VII8_DROME Outer segment 5 OS=Drosophila melanogaster OX=7227 GN=Oseg5 PE=4 SV=2
18	Q9C107	8.81e-05	49.3	815	0.047	0.067	MCL1_SCHPO Minichromosome loss protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcl1 PE=1 SV=1
19	G8G223	2.87e-04	47.4	461	0.028	0.072	G8G223_PIG Coronin OS=Sus scrofa OX=9823 GN=coro1a PE=3 SV=1
20	Q8K057	7.58e-04	46.2	777	0.021	0.032	IFT80_MOUSE Intraflagellar transport protein 80 homolog OS=Mus musculus OX=10090 GN=Ift80 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08792 A2L_zn_ribbon	1.4e+02	13.6	A2L zinc ribbon domain
2	PF12894 ANAPC4_WD40	1.3e-08	46.4	Anaphase-promoting complex subunit 4 WD40 domain
3	PF07275 ArdA	4.8e+02	12.7	Antirestriction protein (ArdA)
4	PF00637 Clathrin	1.1	20.6	Region in Clathrin and VPS
5	PF04053 Coatomer_WDAD	0.25	22.0	Coatomer WD associated region
6	PF08662 eIF2A	96	14.3	Eukaryotic translation initiation factor eIF2A
7	PF00400 WD40	0.057	25.5	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314444

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000238628	0.999	Intraflagellar transport proteins
2	9606.ENSP00000382717	0.997	WD repeat-containing protein 19
3	9606.ENSP00000296266	0.995	Intraflagellar transport protein 122 homolog
4	9606.ENSP00000406012	0.995	Intraflagellar transport protein 140 homolog
5	9606.ENSP00000243344	0.994	Tetratricopeptide repeat protein 21B
6	9606.ENSP00000280333	0.976	Dedicator of cytokinesis protein 1
7	9606.ENSP00000312778	0.968	Intraflagellar transport protein 80 homolog
8	9606.ENSP00000362424	0.966	TRAF3-interacting protein 1
9	9606.ENSP00000264020	0.958	Intraflagellar transport proteins
10	9606.ENSP00000393541	0.957	Intraflagellar transport protein 27 homolog
11	9606.ENSP00000419279	0.955	Intraflagellar transport protein 56
12	9606.ENSP00000264538	0.950	Intraflagellar transport protein 57 homolog
13	9606.ENSP00000320359	0.949	Intraflagellar transport protein 22 homolog
14	9606.ENSP00000323580	0.948	Intraflagellar transport protein 88 homolog
15	9606.ENSP00000362121	0.947	Intraflagellar transport protein 52 homolog
16	9606.ENSP00000260570	0.939	Intraflagellar transport protein 172 homolog
17	9606.ENSP00000380321	0.935	Tubby-related protein 3
18	9606.ENSP00000464443	0.935	Intraflagellar transport protein 20 homolog
19	9606.ENSP00000242591	0.928	Intraflagellar transport protein 81 homolog
20	9606.ENSP00000460850	0.927	Clusterin-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0016043	0.988	cellular component organization
GO:0044782	0.962	cilium organization
GO:0060271	0.951	cilium assembly
GO:0051179	0.537	localization
GO:0051641	0.505	cellular localization
GO:0050789	0.485	regulation of biological process
GO:0051234	0.483	establishment of localization
GO:0050794	0.473	regulation of cellular process
GO:0050896	0.446	response to stimulus
GO:0006810	0.434	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005929	1.000	cilium
GO:0030990	0.995	intraciliary transport particle
GO:0043232	0.968	intracellular non-membrane-bounded organelle
GO:0097542	0.944	ciliary tip
GO:0005856	0.839	cytoskeleton
GO:0005813	0.831	centrosome
GO:0005829	0.571	cytosol
GO:0030992	0.457	intraciliary transport particle B
GO:0016020	0.327	membrane
GO:0036064	0.319	ciliary basal body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]