StarFunc result for job id Q9P2M4

User Input

>input (693 residues)
MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKLKLRALEDRHS
LQSVDSGIPTLEIGNPEPVPCSAVHVRRKQSDSDLIPERAFQSACALPSCAPPAPSSTER
EQSVRKSSTFPRTGYDSVKLYSPTSKALTRSDDVSVCSVSSLGTELSTTLSVSNEDILDL
VVTSSSSAIVTLENDDDPQFTNVTLSSIKETRGLHQQDCVHEAEEGSKLKILGPFSNFFA
RNLLARKQSARLDKHNDLGWKLFGKAPLRENAQKDSKRIQKEYEDKAGRPSKPPSPKQNV
RKNLDFEPLSTTALILEDRPANLPAKPAEEAQKHRQQYEEMVVQAKKRELKEAQRRKKQL
EERCRVEESIGNAVLTWNNEILPNWETMWCSRKVRDLWWQGIPPSVRGKVWSLAIGNELN
ITHELFDICLARAKERWRSLSTGGSEVENEDAGFSAADREASLELIKLDISRTFPNLCIF
QQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQM
AFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLA
CRIWDVFCRDGEEFLFRTALGILKLFEDILTKMDFIHMAQFLTRLPEDLPAEELFASIAT
IQMQSRNKKWAQVLTALQKDSREMEKGSPSLRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2M4	1.000	1.000	1.074E-75	693	1.000	1.000	Q9P2M4.pdb.gz	TBC14_HUMAN TBC1 domain family member 14 OS=Homo sapiens OX=9606 GN=TBC1D14 PE=1 SV=3
2	PDB:4z6yA	0.217	0.506	9.903E-4	273	0.065	0.165	4z6yA.pdb.gz
3	AFDB:Q6UXY8	0.085	0.066	1.306E-1	1006	0.147	0.101	Q6UXY8.pdb.gz	TMC5_HUMAN Transmembrane channel-like protein 5 OS=Homo sapiens OX=9606 GN=TMC5 PE=2 SV=3
4	PDB:4gp2A	0.077	0.122	3.077E-1	342	0.051	0.102	4gp2A.pdb.gz	Crystal Structure of Isoprenoid Synthase from Pyrobaculum Calidifontis
5	PDB:6zu0C	0.079	0.106	3.344E-1	426	0.058	0.094	6zu0C.pdb.gz
6	PDB:7egb9	0.095	0.165	3.486E-1	287	0.062	0.150	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
7	AFDB:Q811T9	0.067	0.057	4.546E-1	852	0.156	0.127	Q811T9.pdb.gz	DISC1_MOUSE Disrupted in schizophrenia 1 homolog OS=Mus musculus OX=10090 GN=Disc1 PE=1 SV=2
8	AFDB:Q63803	0.091	0.066	6.082E-1	1144	0.110	0.066	Q63803.pdb.gz	GNAS1_RAT Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Rattus norvegicus OX=10116 GN=Gnas PE=1 SV=3
9	PDB:1a59A	0.067	0.097	7.369E-1	377	0.055	0.101	1a59A.pdb.gz	Structural adaptations of the cold-active citrate synthase from an Antarctic bacterium.
10	PDB:6vkzA	0.074	0.093	7.682E-1	429	0.053	0.086	6vkzA.pdb.gz	Algal neurotoxin biosynthesis repurposes the terpene cyclase structural fold into anN-prenyltransferase.
11	AFDB:Q9W3K6	0.098	0.090	8.482E-1	801	0.162	0.140	Q9W3K6.pdb.gz	Q9W3K6_DROME LD35927p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2258 PE=1 SV=1
12	PDB:7nj0C	0.087	0.163	9.859E-1	270	0.039	0.100	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
13	PDB:3ripA	0.066	0.075	1.117	568	0.069	0.085	3ripA.pdb.gz
14	AFDB:Q54RN4	0.099	0.121	1.183	532	0.114	0.148	Q54RN4.pdb.gz	Q54RN4_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0283015 PE=4 SV=1
15	PDB:4jaeA	0.071	0.095	1.214	426	0.066	0.108	4jaeA.pdb.gz	Enzyme-substrate complexes of allosteric citrate synthase: Evidence for a novel intermediate in substrate binding.
16	PDB:6ehaA	0.088	0.198	1.319	214	0.036	0.117	6ehaA.pdb.gz	Development and characterization of a new inhibitor of heme oxygenase activity for cancer treatment.
17	AFDB:G5E870	0.099	0.049	1.340	2025	0.131	0.045	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
18	AFDB:Q8WWL7	0.082	0.056	1.397	1395	0.107	0.053	Q8WWL7.pdb.gz	CCNB3_HUMAN G2/mitotic-specific cyclin-B3 OS=Homo sapiens OX=9606 GN=CCNB3 PE=1 SV=2
19	AFDB:Q9NRI5	0.071	0.062	1.397	854	0.143	0.116	Q9NRI5.pdb.gz	DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Homo sapiens OX=9606 GN=DISC1 PE=1 SV=3
20	AFDB:O94462	0.094	0.090	1.456	732	0.156	0.148	O94462.pdb.gz	PUF3_SCHPO mRNA-binding protein puf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=puf3 PE=2 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P2M4	0.0	1435	693	1.000	1.000	TBC14_HUMAN TBC1 domain family member 14 OS=Homo sapiens OX=9606 GN=TBC1D14 PE=1 SV=3
2	O96904	6.80e-79	260	438	0.215	0.340	TBC12_DICDI Drainin OS=Dictyostelium discoideum OX=44689 GN=phgA PE=1 SV=1
3	Q54UM5	5.13e-78	266	733	0.201	0.190	Q54UM5_DICDI RabGAP/TBC domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280955 PE=4 SV=2
4	Q54SA3	9.88e-51	193	1194	0.160	0.093	Q54SA3_DICDI Regulator of chromosome condensation domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0282575 PE=4 SV=1
5	Q09844	1.31e-38	151	472	0.133	0.195	YAE3_SCHPO TBC domain-containing protein C23D3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23D3.03c PE=4 SV=1
6	A0A384L1W6	1.75e-35	139	353	0.131	0.258	A0A384L1W6_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At3g02460 PE=1 SV=1
7	Q9VYY9	1.41e-27	121	807	0.128	0.110	EVI5_DROME Ecotropic viral integration site 5 ortholog OS=Drosophila melanogaster OX=7227 GN=Evi5 PE=1 SV=3
8	O60447	1.90e-26	117	810	0.102	0.088	EVI5_HUMAN Ecotropic viral integration site 5 protein homolog OS=Homo sapiens OX=9606 GN=EVI5 PE=1 SV=3
9	Q96CN4	3.66e-26	116	794	0.108	0.094	EVI5L_HUMAN EVI5-like protein OS=Homo sapiens OX=9606 GN=EVI5L PE=1 SV=1
10	F1LJ00	5.49e-26	116	815	0.121	0.103	F1LJ00_HUMAN TBC1 domain family, member 18 OS=Homo sapiens OX=9606 GN=TBC1D18 PE=2 SV=1
11	Q5R372	5.49e-26	116	815	0.121	0.103	RBG1L_HUMAN Rab GTPase-activating protein 1-like OS=Homo sapiens OX=9606 GN=RABGAP1L PE=1 SV=1
12	Q9Y3P9	9.82e-26	115	1069	0.121	0.079	RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3
13	S6F527	3.14e-25	114	888	0.108	0.084	EAT17_CAEEL Rab GTPase-activating protein eat-17 OS=Caenorhabditis elegans OX=6239 GN=eat-17 PE=1 SV=1
14	Q92738	4.42e-25	113	828	0.113	0.094	US6NL_HUMAN USP6 N-terminal-like protein OS=Homo sapiens OX=9606 GN=USP6NL PE=1 SV=3
15	Q38A97	1.32e-23	106	418	0.107	0.177	Q38A97_TRYB2 GTPase activating protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1770 PE=4 SV=1
16	Q9BXI6	1.11e-21	101	508	0.092	0.126	TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens OX=9606 GN=TBC1D10A PE=1 SV=1
17	O60343	1.36e-21	102	1298	0.121	0.065	TBCD4_HUMAN TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=2
18	A0A3B3IRT3	1.58e-21	102	1054	0.121	0.080	A0A3B3IRT3_HUMAN TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=1
19	Q8C9V1	7.77e-21	98.2	444	0.095	0.149	TB10C_MOUSE Carabin OS=Mus musculus OX=10090 GN=Tbc1d10c PE=1 SV=1
20	Q8BYJ6	8.37e-21	100	1307	0.120	0.064	TBCD4_MOUSE TBC1 domain family member 4 OS=Mus musculus OX=10090 GN=Tbc1d4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00566 RabGAP-TBC	1.4e-46	170.4	Rab-GTPase-TBC domain
2	PF04181 RPAP2_Rtr1	6.9e+02	12.0	Rtr1/RPAP2 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386921

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261890	0.897	Ras-related protein Rab-11A
2	9606.ENSP00000324560	0.879	Serine/threonine-protein kinase ULK1
3	9606.ENSP00000333547	0.817	Ras-related protein Rab-11B
4	9606.ENSP00000324318	0.808	Trafficking protein particle complex subunit 12
5	9606.ENSP00000283351	0.788	Trafficking protein particle complex subunit 8
6	9606.ENSP00000264866	0.772	TBC1 domain family member 19
7	9606.ENSP00000409231	0.722	Belongs to the TRAPPC13 family
8	9606.ENSP00000480332	0.718	Trafficking protein particle complex subunit 3
9	9606.ENSP00000301021	0.710	Trafficking protein particle complex subunit 2-like protein
10	9606.ENSP00000335371	0.689	Trafficking protein particle complex subunit 11
11	9606.ENSP00000361731	0.681	TBC1 domain family member 13
12	9606.ENSP00000405068	0.672	Nucleolar protein 14
13	9606.ENSP00000353549	0.671	Cell division cycle protein 16 homolog
14	9606.ENSP00000436005	0.670	Trafficking protein particle complex subunit 4
15	9606.ENSP00000291574	0.668	Trafficking protein particle complex subunit 10
16	9606.ENSP00000317332	0.648	Sorting nexin-18
17	9606.ENSP00000470262	0.621	Trafficking protein particle complex subunit 5
18	9606.ENSP00000330289	0.616	Trafficking protein particle complex subunit 6B
19	9606.ENSP00000392495	0.611	Trafficking protein particle complex subunit 2
20	9606.ENSP00000377700	0.610	TBC1 domain family member 23

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.999	protein kinase binding
GO:0098772	0.427	molecular function regulator activity
GO:0005096	0.387	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0051649	0.986	establishment of localization in cell
GO:0016192	0.980	vesicle-mediated transport
GO:0046907	0.980	intracellular transport
GO:0050794	0.978	regulation of cellular process
GO:0016197	0.921	endosomal transport
GO:0019222	0.917	regulation of metabolic process
GO:0044087	0.911	regulation of cellular component biogenesis
GO:0016482	0.906	cytosolic transport
GO:0051128	0.876	regulation of cellular component organization
GO:0033043	0.864	regulation of organelle organization
GO:0031323	0.851	regulation of cellular metabolic process
GO:0048193	0.828	Golgi vesicle transport
GO:0010506	0.827	regulation of autophagy
GO:0048523	0.806	negative regulation of cellular process
GO:1902115	0.805	regulation of organelle assembly
GO:0044088	0.781	regulation of vacuole organization
GO:0042147	0.655	retrograde transport, endosome to Golgi
GO:0009895	0.643	negative regulation of catabolic process
GO:0010507	0.614	negative regulation of autophagy
GO:2000785	0.326	regulation of autophagosome assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0070013	0.996	intracellular organelle lumen
GO:0005634	0.996	nucleus
GO:0031410	0.996	cytoplasmic vesicle
GO:0005768	0.993	endosome
GO:0005794	0.992	Golgi apparatus
GO:0005654	0.988	nucleoplasm
GO:0005773	0.971	vacuole
GO:0005829	0.970	cytosol
GO:0055037	0.935	recycling endosome
GO:0005776	0.884	autophagosome
GO:0016020	0.822	membrane
GO:0031090	0.326	organelle membrane
GO:0098588	0.313	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]