StarFunc result for job id Q9P2N4

User Input

>input (1935 residues)
MQFVSWATLLTLLVRDLAEMGSPDAAAAVRKDRLHPRQVKLLETLSEYEIVSPIRVNALG
EPFPTNVHFKRTRRSINSATDPWPAFASSSSSSTSSQAHYRLSAFGQQFLFNLTANAGFI
APLFTVTLLGTPGVNQTKFYSEEEAELKHCFYKGYVNTNSEHTAVISLCSGMLGTFRSHD
GDYFIEPLQSMDEQEDEEEQNKPHIIYRRSAPQREPSTGRHACDTSEHKNRHSKDKKKTR
ARKWGERINLAGDVAALNSGLATEAFSAYGNKTDNTREKRTHRRTKRFLSYPRFVEVLVV
ADNRMVSYHGENLQHYILTLMSIVASIYKDPSIGNLINIVIVNLIVIHNEQDGPSISFNA
QTTLKNFCQWQHSKNSPGGIHHDTAVLLTRQDICRAHDKCDTLGLAELGTICDPYRSCSI
SEDSGLSTAFTIAHELGHVFNMPHDDNNKCKEEGVKSPQHVMAPTLNFYTNPWMWSKCSR
KYITEFLDTGYGECLLNEPESRPYPLPVQLPGILYNVNKQCELIFGPGSQVCPYMMQCRR
LWCNNVNGVHKGCRTQHTPWADGTECEPGKHCKYGFCVPKEMDVPVTDGSWGSWSPFGTC
SRTCGGGIKTAIRECNRPEPKNGGKYCVGRRMKFKSCNTEPCLKQKRDFRDEQCAHFDGK
HFNINGLLPNVRWVPKYSGILMKDRCKLFCRVAGNTAYYQLRDRVIDGTPCGQDTNDICV
QGLCRQAGCDHVLNSKARRDKCGVCGGDNSSCKTVAGTFNTVHYGYNTVVRIPAGATNID
VRQHSFSGETDDDNYLALSSSKGEFLLNGNFVVTMAKREIRIGNAVVEYSGSETAVERIN
STDRIEQELLLQVLSVGKLYNPDVRYSFNIPIEDKPQQFYWNSHGPWQACSKPCQGERKR
KLVCTRESDQLTVSDQRCDRLPQPGHITEPCGTDCDLRWHVASRSECSAQCGLGYRTLDI
YCAKYSRLDGKTEKVDDGFCSSHPKPSNREKCSGECNTGGWRYSAWTECSKSCDGGTQRR
RAICVNTRNDVLDDSKCTHQEKVTIQRCSEFPCPQWKSGDWSECLVTCGKGHKHRQVWCQ
FGEDRLNDRMCDPETKPTSMQTCQQPECASWQAGPWGQCSVTCGQGYQLRAVKCIIGTYM
SVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGSWTPCSATCGK
GTRMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCGQWKALDWSSCSVTCGQGRAT
RQVMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSAS
PSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIKPDEQRACES
GPCPQWAYGNWGECTKLCGGGIRTRLVVCQRSNGERFPDLSCEILDKPPDREQCNTHACP
HDAAWSTGPWSSCSVSCGRGHKQRNVYCMAKDGSHLESDYCKHLAKPHGHRKCRGGRCPK
WKAGAWSQCSVSCGRGVQQRHVGCQIGTHKIARETECNPYTRPESERDCQGPRCPLYTWR
AEEWQECTKTCGEGSRYRKVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGE
WSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYLRDCPVSAT
WRVGNWGSCSVSCGVGVMQRSVQCLTNEDQPSHLCHTDLKPEERKTCRNVYNCELPQNCK
EVKRLKGASEDGEYFLMIRGKLLKIFCAGMHSDHPKEYVTLVHGDSENFSEVYGHRLHNP
TECPYNGSRRDDCQCRKDYTAAGFSSFQKIRIDLTSMQIITTDLQFARTSEGHPVPFATA
GDCYSAAKCPQGRFSINLYGTGLSLTESARWISQGNYAVSDIKKSPDGTRVVGKCGGYCG
KCTPSSGTGLEVRVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PUN6	0.475	0.476	0.000	1931	0.889	0.891	E9PUN6.pdb.gz	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
2	AFDB:F1R6Q4	0.394	0.509	0.000	1461	0.500	0.662	F1R6Q4.pdb.gz
3	AFDB:P59510	0.471	0.476	0.000	1910	0.500	0.507	P59510.pdb.gz	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
4	AFDB:P59511	0.391	0.396	0.000	1906	0.536	0.545	P59511.pdb.gz	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
5	AFDB:Q19791	0.302	0.274	0.000	2150	0.362	0.326	Q19791.pdb.gz	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
6	AFDB:Q8SXB0	0.298	0.336	0.000	1688	0.252	0.289	Q8SXB0.pdb.gz	Q8SXB0_DROME ADAM metallopeptidase with thrombospondin type 1 motif A, isoform B OS=Drosophila melanogaster OX=7227 GN=AdamTS-A PE=2 SV=1
7	AFDB:Q9P2N4	1.000	1.000	0.000	1935	1.000	1.000	Q9P2N4.pdb.gz	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
8	AFDB:Q811B3	0.336	0.400	1.677E-102	1600	0.245	0.296	Q811B3.pdb.gz	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
9	AFDB:Q68SA9	0.346	0.397	2.373E-102	1657	0.254	0.297	Q68SA9.pdb.gz	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
10	AFDB:P58397	0.345	0.412	6.393E-102	1594	0.242	0.294	P58397.pdb.gz	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
11	PDB:1w0rA	0.047	0.153	1.831E-13	442	0.048	0.210	1w0rA.pdb.gz
12	PDB:4q1lA	0.095	0.833	7.536E-12	202	0.031	0.297	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
13	PDB:7q1yA	0.039	0.045	7.601E-8	1374	0.052	0.073	7q1yA.pdb.gz
14	PDB:4lnvA	0.026	0.034	2.624E-7	1276	0.042	0.063	4lnvA.pdb.gz
15	PDB:5a42A	0.039	0.045	3.200E-7	1597	0.053	0.064	5a42A.pdb.gz
16	PDB:7q5zA	0.033	0.042	6.914E-6	1344	0.044	0.063	7q5zA.pdb.gz
17	PDB:7vonA	0.040	0.049	1.958E-5	1399	0.051	0.070	7vonA.pdb.gz
18	PDB:4rtdA	0.025	0.032	3.469E-4	1122	0.036	0.061	4rtdA.pdb.gz
19	PDB:7ufgB	0.080	0.124	4.230E-4	1182	0.050	0.081	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
20	PDB:6h03A	0.044	0.061	5.695E-4	1223	0.037	0.059	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z1A5	0.0	624	1117	0.211	0.366	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
2	E9PUN6	0.0	3549	1931	0.889	0.891	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
3	E9PYV8	0.0	2535	1350	0.627	0.899	E9PYV8_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
4	F1SFS3	0.0	3660	2000	0.917	0.887	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5
5	H0Y859	0.0	2057	991	0.512	0.999	H0Y859_HUMAN ADAM metallopeptidase with thrombospondin type 1 motif 9 (Fragment) OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=1
6	H2L2A7	0.0	1079	2165	0.366	0.327	H2L2A7_CAEEL Peptidase M12B domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=1
7	P59384	0.0	712	950	0.210	0.427	ATS15_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 15 OS=Mus musculus OX=10090 GN=Adamts15 PE=1 SV=2
8	P59510	0.0	1962	1910	0.499	0.506	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
9	P59511	0.0	2153	1906	0.539	0.547	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
10	P97857	0.0	655	968	0.186	0.371	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
11	Q19791	0.0	1088	2150	0.366	0.330	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
12	Q8CDB8	0.0	1229	701	0.308	0.850	Q8CDB8_MOUSE GON domain-containing protein OS=Mus musculus OX=10090 GN=Adamts9 PE=2 SV=1
13	Q9P2N4	0.0	4033	1935	1.000	1.000	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
14	Q9UHI8	0.0	647	967	0.182	0.365	ATS1_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Homo sapiens OX=9606 GN=ADAMTS1 PE=1 SV=4
15	Q9UKP5	0.0	623	1117	0.213	0.369	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
16	Q9UP79	0.0	622	889	0.171	0.372	ATS8_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 8 OS=Homo sapiens OX=9606 GN=ADAMTS8 PE=2 SV=2
17	Q9WUQ1	0.0	660	967	0.188	0.376	ATS1_RAT A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Rattus norvegicus OX=10116 GN=Adamts1 PE=2 SV=1
18	Q4VC17	4.54e-177	573	1219	0.202	0.320	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
19	Q8TE60	9.16e-176	570	1221	0.195	0.310	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
20	Q69ZM2	5.59e-172	525	276	0.131	0.920	Q69ZM2_MOUSE MKIAA1312 protein (Fragment) OS=Mus musculus OX=10090 GN=Adamts9 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	2.9e-14	64.6	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	4.4e-07	41.3	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	2.6e-25	100.4	ADAM-TS Spacer 1
4	PF08685 GON	1.2e-80	281.5	GON domain
5	PF06114 Peptidase_M78	7e+02	11.6	IrrE N-terminal-like domain
6	PF01562 Pep_M12B_propep	3.9e-36	135.8	Reprolysin family propeptide
7	PF01421 Reprolysin	1.2e-24	98.9	Reprolysin (M12B) family zinc metalloprotease
8	PF13574 Reprolysin_2	5.6e-05	34.7	Metallo-peptidase family M12B Reprolysin-like
9	PF13582 Reprolysin_3	1.8e-07	43.1	Metallo-peptidase family M12B Reprolysin-like
10	PF13583 Reprolysin_4	70	14.5	Metallo-peptidase family M12B Reprolysin-like
11	PF13688 Reprolysin_5	3.6e-12	58.4	Metallo-peptidase family M12
12	PF19030 TSP1_ADAMTS	3e-152	506.3	Thrombospondin type 1 domain
13	PF19035 TSP1_CCN	6e-14	63.4	CCN3 Nov like TSP1 domain
14	PF19028 TSP1_spondin	5.9e-27	105.1	Spondin-like TSP1 domain
15	PF00090 TSP_1	2.4e-57	202.2	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000418735

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343002	0.969	Beta-1,3-glucosyltransferase
2	9606.ENSP00000387356	0.956	Aggrecan core protein
3	9606.ENSP00000339613	0.937	GDP-fucose protein O-fucosyltransferase 2
4	9606.ENSP00000274487	0.925	ADAM metallopeptidase with thrombospondin type 1 motif 19
5	9606.ENSP00000369921	0.925	ADAMTS-like protein 1
6	9606.ENSP00000360997	0.924	A disintegrin and metalloproteinase with thrombospondin motifs 13
7	9606.ENSP00000422554	0.924	A disintegrin and metalloproteinase with thrombospondin motifs 12
8	9606.ENSP00000260356	0.921	Thrombospondin-1
9	9606.ENSP00000286657	0.921	A disintegrin and metalloproteinase with thrombospondin motifs 3
10	9606.ENSP00000327608	0.921	ADAMTS-like protein 5
11	9606.ENSP00000346478	0.921	ADAMTS-like protein 2
12	9606.ENSP00000358035	0.921	ADAMTS-like protein 4
13	9606.ENSP00000355751	0.920	Thrombospondin-2
14	9606.ENSP00000362304	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 14
15	9606.ENSP00000373472	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 7
16	9606.ENSP00000483599	0.919	Spondin-2
17	9606.ENSP00000251582	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 2
18	9606.ENSP00000268070	0.918	ADAM metallopeptidase with thrombospondin type 1 motif 17
19	9606.ENSP00000282849	0.916	ADAM metallopeptidase with thrombospondin type 1 motif 18
20	9606.ENSP00000347484	0.916	Thrombospondin type-1 domain-containing protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008237	1.000	metallopeptidase activity
GO:0005488	0.946	binding
GO:0005515	0.939	protein binding
GO:0004175	0.936	endopeptidase activity
GO:0004222	0.560	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.948	organic substance metabolic process
GO:0044238	0.929	primary metabolic process
GO:0006508	0.910	proteolysis
GO:0009987	0.823	cellular process
GO:0050789	0.785	regulation of biological process
GO:0050794	0.730	regulation of cellular process
GO:0050896	0.565	response to stimulus
GO:0032502	0.555	developmental process
GO:0032501	0.464	multicellular organismal process
GO:0048518	0.343	positive regulation of biological process
GO:0048522	0.330	positive regulation of cellular process
GO:0048856	0.318	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0012505	0.990	endomembrane system
GO:0005576	0.990	extracellular region
GO:0043227	0.981	membrane-bounded organelle
GO:0071944	0.976	cell periphery
GO:0005622	0.966	intracellular anatomical structure
GO:0043229	0.955	intracellular organelle
GO:0043231	0.954	intracellular membrane-bounded organelle
GO:0005737	0.939	cytoplasm
GO:0031012	0.891	extracellular matrix
GO:0005615	0.890	extracellular space
GO:0062023	0.812	collagen-containing extracellular matrix
GO:0005783	0.779	endoplasmic reticulum
GO:0070013	0.514	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.560	Metalloendopeptidases.

[back to server]