StarFunc result for job id Q9P2N6

User Input

>input (904 residues)
MAHRGGERDFQTSARRMGTSLLFQLSVHERELDLVFLDHSYAKPWSAHPDASSARPTRML
FVTPRRQHESTIESDVPIDVETVTSTPMPLYDNQKARSVMNECERHVIFARTDADAPPPP
EDWEEHVNRTGWTMAQNKLFNKILKALQSDRLARLANEGACNEPVLRRVAVDKCARRVRQ
ALASVSWDTKLIQWLHTTLVETLSLPMLAAYLDALQTLKGKIPTLIDRMLVSSNTKTGAA
GAEALSLLLKRPWDPAVGVLSHNKPSKLPGSPLILIASSGPSSSVFPTSRRHRFWQSQLS
CLGKVIPVATHLLNNGSGVGVLQCLEHMIGAVRSKVLEIHSHFPHKPIILIGWNTGALVA
CHVSVMEYVTAVVCLGFPLLTVDGPRGDVDDPLLDMKTPVLFVIGQNSLQCHPEAMEDFR
EKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQDEIVDFLTGVLTRAEGHMG
SEPRDQDAEKKKKPRDVARRDLAFEVPERGSRPASPAAKLPASPSGSEDLSSVSSSPTSS
PKTKVTTVTSAQKSSQIGSSQLLKRHVQRTEAVLTHKQAQAQFAAFLKQNMLVRKALPPG
TSSCLFVPISSEPPEEGEKEDLRVQLKRHHPSSPLPGSKTSKRPKIKVSLISQGDTAGGP
CAPSQGSAPEAAGGKPITMTLGQASAGAKELTGLLTTAKSSSSEGGVSASPVPSVVSSST
APSALHTLQSRLVATSPGSSLPGATSASSLLQGLSFSLQDISSKTSGLPANPSPGPAPQA
TSVKLPTPMQSLGAITTGTSTIVRTIPVATTLSSLGATPGGKPTAIHQLLTNGGLAKLAS
SLPGLAQISNQASGLKVPTTITLTLRGQPSRITTLSPMGSGAAPSEESSSQVLPSSSQRL
PPAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2N6	1.000	1.000	0.000	904	1.000	1.000	Q9P2N6.pdb.gz	KANL3_HUMAN KAT8 regulatory NSL complex subunit 3 OS=Homo sapiens OX=9606 GN=KANSL3 PE=1 SV=2
2	AFDB:A0A0B4KFM5	0.413	0.341	3.629E-34	1111	0.250	0.203	A0A0B4KFM5.pdb.gz	A0A0B4KFM5_DROME Reduction in Cnn dots 1, isoform G OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
3	PDB:7prmA	0.174	0.497	1.197E-5	295	0.035	0.108	7prmA.pdb.gz	Development of High Brain-Penetrant and Reversible Monoacylglycerol Lipase PET Tracers for Neuroimaging.
4	PDB:6avvA	0.146	0.523	5.423E-5	210	0.033	0.143	6avvA.pdb.gz
5	PDB:6fvjD	0.153	0.536	7.911E-5	223	0.039	0.157	6fvjD.pdb.gz	Biochemical and Structural Characterization of TesA, a Major Thioesterase Required for Outer-Envelope Lipid Biosynthesis in Mycobacterium tuberculosis.
6	PDB:1fj2A	0.155	0.513	1.606E-4	229	0.033	0.131	1fj2A.pdb.gz
7	PDB:5l2pA	0.164	0.424	1.606E-4	306	0.035	0.105	5l2pA.pdb.gz
8	PDB:3kxpA	0.152	0.452	3.419E-4	268	0.046	0.157	3kxpA.pdb.gz
9	PDB:4xjvA	0.141	0.489	3.585E-4	216	0.029	0.120	4xjvA.pdb.gz
10	PDB:4bzwA	0.166	0.461	4.130E-4	275	0.033	0.109	4bzwA.pdb.gz	Structure, Biochemical Characterization and Analysis of the Pleomorphism of Carboxylesterase Cest-2923 from Lactobacillus Plantarum Wcfs1
11	PDB:5synA	0.150	0.513	4.989E-4	223	0.028	0.112	5synA.pdb.gz	Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2).
12	PDB:4zwnB	0.161	0.421	6.943E-4	311	0.039	0.113	4zwnB.pdb.gz
13	AFDB:Q961B0	0.071	0.066	7.204E-2	1067	0.115	0.097	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
14	AFDB:Q8T145	0.123	0.077	1.211E-1	1789	0.118	0.060	Q8T145.pdb.gz	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2
15	AFDB:Q0D3B6	0.102	0.120	1.463E-1	742	0.103	0.125	Q0D3B6.pdb.gz	PRR37_ORYSJ Two-component response regulator-like PRR37 OS=Oryza sativa subsp. japonica OX=39947 GN=PRR37 PE=2 SV=1
16	AFDB:A0A0G2JZW4	0.096	0.053	2.134E-1	2308	0.140	0.055	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
17	AFDB:H8ESG1	0.045	0.032	4.993E-1	1494	0.126	0.076	H8ESG1.pdb.gz	H8ESG1_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
18	AFDB:F4HZK4	0.067	0.048	8.393E-1	1608	0.108	0.061	F4HZK4.pdb.gz	REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3 OS=Arabidopsis thaliana OX=3702 GN=REC3 PE=3 SV=1
19	AFDB:F4HS99	0.085	0.053	1.479	1797	0.104	0.052	F4HS99.pdb.gz	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
20	AFDB:Q9FHI4	0.078	0.064	1.704	1167	0.097	0.075	Q9FHI4.pdb.gz	Q9FHI4_ARATH Leucine-rich repeat (LRR) family protein OS=Arabidopsis thaliana OX=3702 GN=MFC19.19 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RSY1	0.0	1664	903	0.945	0.946	KANL3_MOUSE KAT8 regulatory NSL complex subunit 3 OS=Mus musculus OX=10090 GN=Kansl3 PE=1 SV=1
2	Q9P2N6	0.0	1823	904	1.000	1.000	KANL3_HUMAN KAT8 regulatory NSL complex subunit 3 OS=Homo sapiens OX=9606 GN=KANSL3 PE=1 SV=2
3	Q8T076	1.36e-83	293	1066	0.181	0.154	Q8T076_DROME LD22513p OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
4	A1Z9L2	1.69e-83	290	934	0.180	0.175	A1Z9L2_DROME Reduction in Cnn dots 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
5	A1Z9L0	2.03e-83	291	1001	0.180	0.163	A1Z9L0_DROME LD05087p OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
6	A0A0B4KFM5	2.16e-83	293	1111	0.180	0.147	A0A0B4KFM5_DROME Reduction in Cnn dots 1, isoform G OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
7	A0A0B4LFC1	2.49e-83	292	1108	0.180	0.147	A0A0B4LFC1_DROME Reduction in Cnn dots 1, isoform H OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
8	A0A0B4KFX4	2.67e-83	291	1046	0.180	0.156	A0A0B4KFX4_DROME Reduction in Cnn dots 1, isoform F OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
9	A0A0B4KF25	2.75e-83	293	1131	0.180	0.144	A0A0B4KF25_DROME Reduction in Cnn dots 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
10	A0A0B4KEP1	4.27e-83	291	1066	0.180	0.153	A0A0B4KEP1_DROME Reduction in Cnn dots 1, isoform D OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
11	Q9DDT2	0.23	37.7	800	0.030	0.034	BCAP_CHICK Phosphoinositide 3-kinase adapter protein 1 OS=Gallus gallus OX=9031 GN=PIK3AP1 PE=1 SV=1
12	G3V6S0	2.4	34.7	2361	0.041	0.016	G3V6S0_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=4
13	Q6XD99	2.4	34.7	2358	0.041	0.016	Q6XD99_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=2 SV=1
14	Q6ZUJ8	3.7	33.9	805	0.027	0.030	BCAP_HUMAN Phosphoinositide 3-kinase adapter protein 1 OS=Homo sapiens OX=9606 GN=PIK3AP1 PE=1 SV=2
15	Q8RWH9	4.9	33.1	513	0.045	0.080	NUP58_ARATH Nuclear pore complex protein NUP58 OS=Arabidopsis thaliana OX=3702 GN=NUP58 PE=1 SV=1
16	O73823	5.9	32.7	394	0.024	0.056	TAL1_XENLA T-cell acute lymphocytic leukemia protein 1 OS=Xenopus laevis OX=8355 GN=tal1 PE=2 SV=1
17	Q5D002	9.1	32.3	516	0.041	0.072	Q5D002_RAT Sptbn1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20408 Abhydrolase_11	0.0022	29.2	Alpha/beta hydrolase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000000397

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000005412	0.971	KAT8 regulatory NSL complex subunit 1
2	9593.ENSGGOP00000001651	0.963	PHD finger protein 20
3	9593.ENSGGOP00000001545	0.954	Microspherule protein 1
4	9593.ENSGGOP00000012759	0.926	KAT8 regulatory NSL complex subunit 2
5	9593.ENSGGOP00000013275	0.917	K(lysine) acetyltransferase 8
6	9593.ENSGGOP00000004898	0.904	WD repeat domain 5
7	9593.ENSGGOP00000010875	0.868	KAT8 regulatory NSL complex subunit 1-like
8	9593.ENSGGOP00000014511	0.797	O-linked N-acetylglucosamine (GlcNAc) transferase
9	9593.ENSGGOP00000009580	0.752	Host cell factor C1
10	9593.ENSGGOP00000005695	0.693	PHD finger protein 23
11	9593.ENSGGOP00000000573	0.666	Lysine (K)-specific methyltransferase 2E
12	9593.ENSGGOP00000003226	0.654	K(lysine) acetyltransferase 5
13	9593.ENSGGOP00000012213	0.652	ADAM metallopeptidase domain 23
14	9593.ENSGGOP00000026850	0.651	Chemokine (C-X-C motif) ligand 11
15	9593.ENSGGOP00000028132	0.650	Signal peptide peptidase like 2C
16	9593.ENSGGOP00000008565	0.646	K(lysine) acetyltransferase 6B
17	9593.ENSGGOP00000021743	0.646	ADAM metallopeptidase domain 11
18	9593.ENSGGOP00000024510	0.646	K(lysine) acetyltransferase 6A
19	9593.ENSGGOP00000025796	0.646	K(lysine) acetyltransferase 7
20	9593.ENSGGOP00000003955	0.638	SET domain containing 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.554	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0080090	0.982	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0048518	0.981	positive regulation of biological process
GO:0031323	0.981	regulation of cellular metabolic process
GO:0006473	0.975	protein acetylation
GO:0043967	0.972	histone H4 acetylation
GO:0010604	0.970	positive regulation of macromolecule metabolic process
GO:0051173	0.969	positive regulation of nitrogen compound metabolic process
GO:0031056	0.965	regulation of histone modification
GO:0048522	0.963	positive regulation of cellular process
GO:0031325	0.954	positive regulation of cellular metabolic process
GO:0031401	0.874	positive regulation of protein modification process
GO:0031058	0.860	positive regulation of histone modification
GO:0031060	0.853	regulation of histone methylation
GO:0031062	0.739	positive regulation of histone methylation
GO:0010468	0.726	regulation of gene expression
GO:0009987	0.434	cellular process
GO:0019219	0.403	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0044545	0.998	NSL complex
GO:0005737	0.745	cytoplasm
GO:0140513	0.312	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]