StarFunc result for job id Q9P2P1

User Input

>input (1898 residues)
MLLSGGDPPAQEWFMVQTKSKPRVQRQRLQVQRIFRVKLNAFQSRPDTPYFWLQLEGPRE
NMGKAKEYLKGLCSPELWKEVRYPPILHCAFLGAQGLFLDCLCWSTLAYLVPGPPGSLMV
GGLTESFIMTQNWLEELVGRLRWGPAPLLTPRGIWEAEVTRAFGALVWIRGDQHAGDLLQ
LPPAVQELLLSLVRDAAGKEDIIEWLSRFGISDSHSDPEVLICPPQQQKEAPAMVSVGES
PGPFVDMGTLQNRGPENSKRLSSLGATGSLITAQSTPQEAANQLVRVGSNNQDGMDSAQE
EGTVQATSSQDSTNHTQALLKQRQVQKIEDKLLFQPPVSALGVCPPWKAWTPGPAFGPLW
PGAIAATFWRINELHSLHLAWLLSQACFNFPFWQRPLGPIQLKLPGQNPLPLNLEWKQKE
LAPLPSAESPAGRPDGGLGGEAALQNCPRPEISPKVTSLLVVPGSSDVKDKVSSDLPQIG
PPLTSTPQLQAGGEPGDQGSMQLDFKGLEEGPAPVLPTGQGKPVAQGGLTDQSVPGAQTV
PETLKVPMAAAVPKAENPSRTQVPSAAPKLPTSRMMLAVHTEPAAPEVPLAPTKPTAQLM
ATAQKTVVNQPVLVAQVEPTTPKTPQAQKMPVAKTSPAGPKTPKAQAGPAATVSKAPAAS
KAPAAPKVPVTPRVSRAPKTPAAQKVPTDAGPTLDVARLLSEVQPTSRASVSLLKGQGQA
GRQGPQSSGTLALSSKHQFQMEGLLGAWEGAPRQPPRHLQANSTVTSFQRYHEALNTPFE
LNLSGEPGNQGLRRVVIDGSSVAMVHGLQHFFSCRGIAMAVQFFWNRGHREVTVFVPTWQ
LKKNRRVRESHFLTKLHSLKMLSITPSQLENGKKITTYDYRFMVKLAEETDGIIVTNEQI
HILMNSSKKLMVKDRLLPFTFAGNLFMVPDDPLGRDGPTLDEFLKKPNRLDTDIGNFLKV
WKTLPPSSASVTELSDDADSGPLESLPNMEEVREEKEERQDEEQRQGQGTQKAAEEDDLD
SSLASVFRVECPSLSEEILRCLSLHDPPDGALDIDLLPGAASPYLGIPWDGKAPCQQVLA
HLAQLTIPSNFTALSFFMGFMDSHRDAIPDYEALVGPLHSLLKQKPDWQWDQEHEEAFLA
LKRALVSALCLMAPNSQLPFRLEVTVSHVALTAILHQEHSGRKHPIAYTSKPLLPDEESQ
GPQSGGDSPYAVAWALKHFSRCIGDTPVVLDLSYASRTTADPEVREGRRVSKAWLIRWSL
LVQDKGKRALELALLQGLLGENRLLTPAASMPRFFQVLPPFSDLSTFVCIHMSGYCFYRE
DEWCAGFGLYVLSPTSPPVSLSFSCSPYTPTYAHLAAVACGLERFGQSPLPVVFLTHCNW
IFSLLWELLPLWRARGFLSSDGAPLPHPSLLSYIISLTSGLSSLPFIYRTSYRGSLFAVT
VDTLAKQGAQGGGQWWSLPKDVPAPTVSPHAMGKRPNLLALQLSDSTLADIIARLQAGQK
LSGSSPFSSAFNSLSLDKESGLLMFKGDKKPRVWVVPTQLRRDLIFSVHDIPLGAHQRPE
ETYKKLRLLGWWPGMQEHVKDYCRSCLFCIPRNLIGSELKVIESPWPLRSTAPWSNLQIE
VVGPVTISEEGHKHVLIVADPNTRWVEAFPLKPYTHTAVAQVLLQHVFARWGVPVRLEAA
QGPQFARHVLVSCGLALGAQVASLSRDLQFPCLTSSGAYWEFKRALKEFIFLHGKKWAAS
LPLLHLAFRASSTDATPFKVLTGGESRLTEPLWWEMSSANIEGLKMDVFLLQLVGELLEL
HWRVADKASEKAENRRFKRESQEKEWNVGDQVLLLSLPRNGSSAKWVGPFYIGDRLSLSL
YRIWGFPTPEKLGCIYPSSLMKAFAKSGTPLSFKVLEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7q5bB	0.148	0.449	1.547E-10	482	0.035	0.139	7q5bB.pdb.gz	Structural basis of Ty3 retrotransposon integration at RNA Polymerase III-transcribed genes.
2	PDB:6vrdA	0.072	0.801	1.296E-6	149	0.015	0.195	6vrdA.pdb.gz	Crystal structure of RNase H/RNA/PS-ASO complex at an atomic level
3	PDB:2jleA	0.075	0.222	3.281E-6	545	0.022	0.075	2jleA.pdb.gz	Novel Indazole Non-Nucleoside Reverse Transcriptase Inhibitors Using Molecular Hybridization Based on Crystallographic Overlays.
4	PDB:1rddA	0.070	0.734	2.104E-5	155	0.014	0.168	1rddA.pdb.gz	Crystal structure of Escherichia coli RNase HI in complex with Mg2+ at 2.8 A resolution: proof for a single Mg(2+)-binding site.
5	PDB:6pbzA	0.053	0.158	4.656E-4	485	0.030	0.115	6pbzA.pdb.gz
6	PDB:6pbzD	0.045	0.139	2.429E-3	454	0.027	0.115	6pbzD.pdb.gz
7	PDB:1u6zB	0.047	0.133	7.560E-3	500	0.027	0.102	1u6zB.pdb.gz
8	PDB:4a2bA	0.035	0.138	3.046E-2	386	0.014	0.067	4a2bA.pdb.gz	Ftsa Forms Actin-Like Protofilaments
9	AFDB:Q9P7E8	0.026	0.046	4.153E-2	857	0.058	0.130	Q9P7E8.pdb.gz	APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=app1 PE=2 SV=1
10	PDB:5eouA	0.041	0.180	4.372E-2	333	0.021	0.120	5eouA.pdb.gz	PilN Binding Modulates the Structure and Binding Partners of the Pseudomonas aeruginosa Type IVa Pilus Protein PilM.
11	PDB:5eq6A	0.041	0.159	5.659E-2	357	0.022	0.115	5eq6A.pdb.gz	PilN Binding Modulates the Structure and Binding Partners of the Pseudomonas aeruginosa Type IVa Pilus Protein PilM.
12	AFDB:Q9R0I7	0.036	0.047	6.959E-2	1386	0.078	0.107	Q9R0I7.pdb.gz	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2
13	AFDB:Q3V089	0.035	0.051	7.328E-2	1013	0.081	0.151	Q3V089.pdb.gz	RBM44_MOUSE RNA-binding protein 44 OS=Mus musculus OX=10090 GN=Rbm44 PE=1 SV=1
14	AFDB:A1ZBJ6	0.037	0.046	2.057E-1	1379	0.084	0.115	A1ZBJ6.pdb.gz	A1ZBJ6_DROME Rad, Gem/Kir family member 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Rgk1 PE=4 SV=2
15	AFDB:Q867Z4	0.033	0.043	2.166E-1	970	0.068	0.133	Q867Z4.pdb.gz	LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=1
16	AFDB:Q9LE42	0.042	0.046	3.274E-1	1670	0.083	0.095	Q9LE42.pdb.gz	HAC5_ARATH Histone acetyltransferase HAC5 OS=Arabidopsis thaliana OX=3702 GN=HAC5 PE=2 SV=1
17	AFDB:B0V0H4	0.038	0.054	3.447E-1	1071	0.062	0.110	B0V0H4.pdb.gz
18	AFDB:D3ZRA6	0.026	0.029	3.822E-1	1683	0.080	0.090	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
19	AFDB:Q95RC8	0.036	0.047	4.025E-1	1280	0.066	0.098	Q95RC8.pdb.gz	Q95RC8_DROME LD44171p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
20	AFDB:Q8N3D4	0.033	0.037	4.462E-1	1523	0.080	0.100	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15037	1.26e-71	257	678	0.066	0.186	KHNYN_HUMAN Protein KHNYN OS=Homo sapiens OX=9606 GN=KHNYN PE=1 SV=3
2	O75113	1.17e-55	213	896	0.051	0.107	N4BP1_HUMAN NEDD4-binding protein 1 OS=Homo sapiens OX=9606 GN=N4BP1 PE=1 SV=4
3	Q6A037	5.52e-55	211	893	0.048	0.103	N4BP1_MOUSE NEDD4-binding protein 1 OS=Mus musculus OX=10090 GN=N4bp1 PE=1 SV=2
4	Q5D1E8	1.90e-40	162	599	0.041	0.130	ZC12A_HUMAN Endoribonuclease ZC3H12A OS=Homo sapiens OX=9606 GN=ZC3H12A PE=1 SV=1
5	Q5D1E7	2.85e-40	161	596	0.041	0.129	ZC12A_MOUSE Endoribonuclease ZC3H12A OS=Mus musculus OX=10090 GN=Zc3h12a PE=1 SV=2
6	Q8BIY3	2.95e-40	160	533	0.042	0.150	ZC12D_MOUSE Probable ribonuclease ZC3H12D OS=Mus musculus OX=10090 GN=Zc3h12d PE=2 SV=2
7	Q9C0D7	7.26e-40	163	883	0.041	0.088	ZC12C_HUMAN Probable ribonuclease ZC3H12C OS=Homo sapiens OX=9606 GN=ZC3H12C PE=1 SV=2
8	A2A288	2.43e-37	151	527	0.040	0.142	ZC12D_HUMAN Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3
9	P14350	6.04e-13	77.0	1143	0.055	0.091	POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus OX=11963 GN=pol PE=1 SV=2
10	B7ZBA4	7.41e-12	67.8	167	0.015	0.174	B7ZBA4_HUMAN Zinc finger CCCH-type containing 12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=1
11	P0CT40	1.85e-10	68.9	1333	0.032	0.045	TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-9 PE=3 SV=1
12	P03355	2.79e-09	65.1	1738	0.044	0.048	POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) OX=928306 GN=gag-pol PE=1 SV=5
13	A1Z651	4.33e-09	64.3	1733	0.040	0.044	POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) OX=373193 GN=gag-pol PE=1 SV=1
14	Q8UN00	6.06e-09	63.9	1738	0.044	0.048	Q8UN00_MLVMO Gag-Pol polyprotein OS=Moloney murine leukemia virus OX=11801 GN=gag-pro-pol PE=1 SV=1
15	G4SLH0	7.04e-09	63.9	18562	0.036	0.004	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
16	Q7M732	9.38e-05	50.1	1744	0.017	0.019	RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus OX=10090 GN=Rtl1 PE=2 SV=1
17	Q7LHG5	2.72e-04	48.5	1498	0.042	0.053	YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2
18	Q99315	3.49e-04	48.1	1547	0.024	0.029	YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3
19	O95625	0.011	43.1	1053	0.011	0.020	ZBT11_HUMAN Zinc finger and BTB domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZBTB11 PE=1 SV=2
20	M9PCJ6	0.020	42.7	18641	0.038	0.004	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17921 Integrase_H2C2	1.1e-11	56.0	Integrase zinc binding domain
2	PF11977 RNase_Zc3h12a	1.1e-49	179.6	Zc3h12a-like Ribonuclease NYN domain
3	PF17917 RT_RNaseH	0.0064	28.1	RNase H-like domain found in reverse transcriptase
4	PF17919 RT_RNaseH_2	1.3e-13	62.2	RNase H-like domain found in reverse transcriptase
5	PF00665 rve	3.6e+02	12.8	Integrase core domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371994

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382327	0.758	Epimerase family protein SDR39U1
2	9606.ENSP00000315383	0.746	Retroviral-like aspartic protease 1
3	9606.ENSP00000442478	0.714	Stomatin-like protein 1
4	9606.ENSP00000324302	0.707	Syntaxin-binding protein 6
5	9606.ENSP00000215531	0.688	Small integral membrane protein 24
6	9606.ENSP00000402301	0.634	Lysosomal-associated transmembrane protein 4B
7	9606.ENSP00000386184	0.632	Protein ZBED8
8	9606.ENSP00000326200	0.623	Zinc finger and BTB domain-containing protein 11
9	9606.ENSP00000361728	0.618	Protein BEX3
10	9606.ENSP00000259883	0.605	PiggyBac transposable element-derived protein 1
11	9606.ENSP00000328017	0.600	KRAB-A domain containing 2
12	9606.ENSP00000369979	0.588	Probable carboxypeptidase X1
13	9606.ENSP00000362170	0.577	Nuclear apoptosis-inducing factor 1
14	9606.ENSP00000356849	0.564	Pogo transposable element derived with KRAB domain
15	9606.ENSP00000412461	0.536	Rho GTPase-activating protein 22
16	9606.ENSP00000305533	0.524	DNA transposase THAP9
17	9606.ENSP00000255324	0.518	RING finger protein 17
18	9606.ENSP00000378536	0.517	Zinc finger and BTB domain-containing protein 46

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:1901363	0.627	heterocyclic compound binding
GO:0097159	0.627	organic cyclic compound binding
GO:0003676	0.539	nucleic acid binding
GO:0003824	0.507	catalytic activity
GO:0016788	0.326	hydrolase activity, acting on ester bonds

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0019222	0.963	regulation of metabolic process
GO:0048519	0.953	negative regulation of biological process
GO:0048518	0.770	positive regulation of biological process
GO:0048523	0.702	negative regulation of cellular process
GO:0060255	0.677	regulation of macromolecule metabolic process
GO:0051171	0.608	regulation of nitrogen compound metabolic process
GO:0008152	0.603	metabolic process
GO:0080090	0.603	regulation of primary metabolic process
GO:0071704	0.572	organic substance metabolic process
GO:0044238	0.479	primary metabolic process
GO:0051179	0.468	localization
GO:0050896	0.465	response to stimulus
GO:0006807	0.439	nitrogen compound metabolic process
GO:0043170	0.432	macromolecule metabolic process
GO:0010468	0.419	regulation of gene expression
GO:0031323	0.396	regulation of cellular metabolic process
GO:0071840	0.312	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.986	cytosol
GO:0005634	0.958	nucleus
GO:0043232	0.921	intracellular non-membrane-bounded organelle
GO:0070013	0.864	intracellular organelle lumen
GO:0031981	0.776	nuclear lumen
GO:0005654	0.576	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.326	Acting on ester bonds.

[back to server]