StarFunc result for job id Q9P2P5

User Input

>input (1572 residues)
MASSAREHLLFVRRRNPQMRYTLSPENLQSLAAQSSMPENMTLQRANSDTDLVTSESRSS
LTASMYEYTLGQAQNLIIFWDIKEEVDPSDWIGLYHIDENSPANFWDSKNRGVTGTQKGQ
IVWRIEPGPYFMEPEIKICFKYYHGISGALRATTPCITVKNPAVMMGAEGMEGGASGNLH
SRKLVSFTLSDLRAVGLKKGMFFNPDPYLKMSIQPGKKSSFPTCAHHGQERRSTIISNTT
NPIWHREKYSFFALLTDVLEIEIKDKFAKSRPIIKRFLGKLTIPVQRLLERQAIGDQMLS
YNLGRRLPADHVSGYLQFKVEVTSSVHEDASPEAVGTILGVNSVNGDLGSPSDDEDMPGS
HHDSQVCSNGPVSEDSAADGTPKHSFRTSSTLEIDTEELTSTSSRTSPPRGRQDSLNDYL
DAIEHNGHSRPGTATCSERSMGASPKLRSSFPTDTRLNAMLHIDSDEEDHEFQQDLGYPS
SLEEEGGLIMFSRASRADDGSLTSQTKLEDNPVENEEASTHEAASFEDKPENLPELAESS
LPAGPAPEEGEGGPEPQPSADQGSAELCGSQEVDQPTSGADTGTSDASGGSRRAVSETES
LDQGSEPSQVSSETEPSDPARTESVSEASTRPEGESDLECADSSCNESVTTQLSSVDTRC
SSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQESVCTAGSLPVVQVPSGEDEGP
GAESATVPDQEELGEVWQRRGSLEGAAAAAESPPQEEGSAGEAQGTCEGATAQEEGATGG
SQANGHQPLRSLPSVRQDVSRYQRVDEALPPNWEARIDSHGRIFYVDHVNRTTTWQRPTA
PPAPQVLQRSNSIQQMEQLNRRYQSIRRTMTNERPEENTNAIDGAGEEADFHQASADFRR
ENILPHSTSRSRITLLLQSPPVKFLISPEFFTVLHSNPSAYRMFTNNTCLKHMITKVRRD
THHFERYQHNRDLVGFLNMFANKQLELPRGWEMKHDHQGKAFFVDHNSRTTTFIDPRLPL
QSSRPTSALVHRQHLTRQRSHSAGEVGEDSRHAGPPVLPRPSSTFNTVSRPQYQDMVPVA
YNDKIVAFLRQPNIFEILQERQPDLTRNHSLREKIQFIRTEGTPGLVRLSSDADLVMLLS
LFEEEIMSYVPPHALLHPSYCQSPRGSPVSSPQNSPGTQRANARAPAPYKRDFEAKLRNF
YRKLETKGYGQGPGKLKLIIRRDHLLEDAFNQIMGYSRKDLQRNKLYVTFVGEEGLDYSG
PSREFFFLVSRELFNPYYGLFEYSANDTYTVQISPMSAFVDNHHEWFRFSGRILGLALIH
QYLLDAFFTRPFYKALLRILCDLSDLEYLDEEFHQSLQWMKDNDIHDILDLTFTVNEEVF
GQITERELKPGGANIPVTEKNKKEYIERMVKWRIERGVVQQTESLVRGFYEVVDARLVSV
FDARELELVIAGTAEIDLSDWRNNTEYRGGYHDNHIVIRWFWAAVERFNNEQRLRLLQFV
TGTSSIPYEGFASLRGSNGPRRFCVEKWGKITALPRAHTCFNRLDLPPYPSFSMLYEKLL
TAVEETSTFGLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2P5	1.000	1.000	0.000	1572	1.000	1.000	Q9P2P5.pdb.gz	HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens OX=9606 GN=HECW2 PE=1 SV=2
2	AFDB:A2A5Z6	0.205	0.406	2.915E-47	748	0.172	0.361	A2A5Z6.pdb.gz	SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus OX=10090 GN=Smurf2 PE=1 SV=1
3	PDB:7jq9A	0.161	0.106	6.581E-30	2427	0.096	0.062	7jq9A.pdb.gz
4	PDB:7mopA	0.149	0.097	8.704E-29	2445	0.092	0.059	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
5	AFDB:Q9JIR4	0.062	0.060	7.552E-7	1615	0.088	0.086	Q9JIR4.pdb.gz	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
6	AFDB:P14738	0.068	0.090	2.206E-6	1018	0.067	0.103	P14738.pdb.gz	FNBA_STAA8 Fibronectin-binding protein A OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=fnbA PE=1 SV=1
7	AFDB:Q99NE5	0.056	0.060	7.829E-6	1463	0.102	0.110	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
8	AFDB:A0A2R8QRK0	0.051	0.056	1.274E-5	1420	0.076	0.085	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
9	AFDB:Q6WKZ4	0.076	0.092	2.287E-5	1283	0.096	0.118	Q6WKZ4.pdb.gz	RFIP1_HUMAN Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3
10	PDB:1cjyA	0.067	0.157	3.573E-5	633	0.021	0.052	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
11	AFDB:Q96MS0	0.046	0.051	4.523E-5	1386	0.078	0.088	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
12	PDB:5izrC	0.066	0.150	5.816E-5	659	0.017	0.039	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
13	AFDB:Q57WH0	0.066	0.082	9.862E-5	1241	0.092	0.116	Q57WH0.pdb.gz	Q57WH0_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.500 PE=4 SV=1
14	PDB:4gnkB	0.081	0.156	1.150E-4	769	0.014	0.029	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
15	PDB:3nsjA	0.065	0.185	1.468E-4	530	0.018	0.055	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
16	PDB:5iz5A	0.069	0.136	1.618E-4	757	0.016	0.033	5iz5A.pdb.gz
17	PDB:6kxkD	0.069	0.171	2.389E-4	553	0.026	0.074	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
18	PDB:5ixcA	0.067	0.147	2.634E-4	684	0.016	0.037	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
19	AFDB:Q8N3D4	0.060	0.061	2.743E-4	1523	0.150	0.155	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
20	PDB:4rj9A	0.072	0.595	8.076E-4	161	0.016	0.155	4rj9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q76N89	0.0	1308	1606	0.416	0.407	HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens OX=9606 GN=HECW1 PE=1 SV=3
2	Q9P2P5	0.0	3262	1572	1.000	1.000	HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens OX=9606 GN=HECW2 PE=1 SV=2
3	Q9W326	0.0	758	1426	0.230	0.253	Q9W326_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Hecw PE=2 SV=3
4	Q3KRP0	3.76e-139	454	910	0.185	0.320	Q3KRP0_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=si:ch211-79l17.5 PE=2 SV=1
5	P46935	2.45e-127	421	887	0.127	0.224	NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus OX=10090 GN=Nedd4 PE=1 SV=3
6	F1LRN8	2.80e-126	417	856	0.149	0.275	F1LRN8_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=4
7	A0A8I6A6J7	1.38e-125	417	921	0.149	0.255	A0A8I6A6J7_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
8	A0A0G2JUY1	2.25e-125	417	921	0.149	0.255	A0A0G2JUY1_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=2
9	A0A8I6GKS9	2.54e-125	417	942	0.149	0.249	A0A8I6GKS9_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
10	Q62940	6.99e-125	415	887	0.125	0.222	NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 OS=Rattus norvegicus OX=10116 GN=Nedd4 PE=1 SV=1
11	P39940	2.69e-124	410	809	0.154	0.299	RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSP5 PE=1 SV=1
12	Q9VVI3	3.69e-124	416	1007	0.125	0.195	NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster OX=7227 GN=Nedd4 PE=1 SV=2
13	P46934	2.20e-123	421	1319	0.123	0.146	NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens OX=9606 GN=NEDD4 PE=1 SV=4
14	Q92462	1.34e-120	399	767	0.149	0.306	PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub1 PE=1 SV=2
15	U6C7R6	1.57e-120	402	867	0.148	0.269	U6C7R6_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=itcha PE=1 SV=1
16	Q5U1Z5	2.41e-120	387	440	0.120	0.427	Q5U1Z5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=2 SV=1
17	Q5BDP1	2.89e-119	397	821	0.124	0.238	RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=hulA PE=1 SV=1
18	A0A8I6GL04	1.13e-117	395	912	0.120	0.206	A0A8I6GL04_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
19	O14326	1.13e-117	392	786	0.124	0.248	PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub3 PE=2 SV=1
20	A0A8I6AIV5	1.26e-117	394	872	0.120	0.216	A0A8I6AIV5_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2.1e-08	45.8	C2 domain
2	PF00632 HECT	2.4e-97	337.7	HECT-domain (ubiquitin-transferase)
3	PF18436 HECW1_helix	2e-34	128.8	Helical box domain of E3 ubiquitin-protein ligase HECW1
4	PF16562 HECW_N	2.2e-57	203.5	N-terminal domain of E3 ubiquitin-protein ligase HECW1 and 2
5	PF15289 RFXA_RFXANK_bdg	2.4e+02	13.3	Regulatory factor X-associated C-terminal binding domain
6	PF00397 WW	8.2e-14	62.7	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260983

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387739	0.775	Angiomotin-like protein 1
2	9606.ENSP00000252744	0.713	Zinc finger SWIM-type containing 6
3	9606.ENSP00000401536	0.641	DNA-binding protein RFX8
4	9606.ENSP00000263955	0.636	Serine/threonine-protein kinase 17B
5	9606.ENSP00000400906	0.636	Ubiquitin-conjugating enzyme E2L 3
6	9606.ENSP00000238714	0.607	Poly(A) polymerase gamma
7	9606.ENSP00000328287	0.607	E3 ubiquitin-protein ligase RNF123
8	9606.ENSP00000381693	0.604	Zinc finger SWIM-type containing 8
9	9606.ENSP00000379217	0.592	Ubiquitin domain-containing protein UBFD1
10	9606.ENSP00000269305	0.585	Cellular tumor antigen p53
11	9606.ENSP00000402505	0.578	C3 and PZP like, alpha-2-macroglobulin domain containing 8
12	9606.ENSP00000278412	0.574	FACT complex subunit SSRP1
13	9606.ENSP00000295851	0.574	Abl interactor 2
14	9606.ENSP00000306682	0.574	Protein phosphatase 1D
15	9606.ENSP00000262419	0.572	KAT8 regulatory NSL complex subunit 1
16	9606.ENSP00000378199	0.567	Heat shock-related 70 kDa protein 2
17	9606.ENSP00000261366	0.562	Lamin-B1
18	9606.ENSP00000336687	0.547	Chromobox protein homolog 3
19	9606.ENSP00000261427	0.536	Ubiquitin-conjugating enzyme E2 K
20	9606.ENSP00000296328	0.532	UBX domain-containing protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.991	catalytic activity, acting on a protein
GO:0004842	0.967	ubiquitin-protein transferase activity
GO:0061630	0.337	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051128	0.876	regulation of cellular component organization
GO:0033044	0.833	regulation of chromosome organization
GO:0051726	0.790	regulation of cell cycle
GO:0051983	0.777	regulation of chromosome segregation
GO:1901987	0.712	regulation of cell cycle phase transition
GO:0009987	0.683	cellular process
GO:1901990	0.648	regulation of mitotic cell cycle phase transition
GO:0033045	0.611	regulation of sister chromatid segregation
GO:1902099	0.581	regulation of metaphase/anaphase transition of cell cycle
GO:0030071	0.538	regulation of mitotic metaphase/anaphase transition
GO:0048519	0.406	negative regulation of biological process
GO:0048523	0.393	negative regulation of cellular process
GO:0008152	0.385	metabolic process
GO:0019222	0.379	regulation of metabolic process
GO:0044238	0.373	primary metabolic process
GO:0071704	0.370	organic substance metabolic process
GO:0060255	0.344	regulation of macromolecule metabolic process
GO:0006807	0.328	nitrogen compound metabolic process
GO:0043170	0.311	macromolecule metabolic process
GO:0050896	0.306	response to stimulus
GO:0048518	0.304	positive regulation of biological process
GO:0080090	0.304	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0005737	0.977	cytoplasm
GO:0005856	0.973	cytoskeleton
GO:0005829	0.948	cytosol
GO:0043231	0.839	intracellular membrane-bounded organelle
GO:0015630	0.799	microtubule cytoskeleton
GO:0005819	0.730	spindle
GO:0016020	0.683	membrane
GO:0031981	0.428	nuclear lumen
GO:0005654	0.401	nucleoplasm
GO:0072686	0.300	mitotic spindle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.968	Transferases.

[back to server]