StarFunc result for job id Q9P2P6

User Input

>input (1400 residues)
MANVQVAVRVRPLSKRETKEGGRIIVEVDGKVAKIRNLKVDNRPDGFGDSREKVMAFGFD
YCYWSVNPEDPQYASQDVVFQDLGMEVLSGVAKGYNICLFAYGQTGSGKTYTMLGTPASV
GLTPRICEGLFVREKDCASLPSSCRIKVSFLEIYNERVRDLLKQSGQKKSYTLRVREHPE
MGPYVQGLSQHVVTNYKQVIQLLEEGIANRITAATHVHEASSRSHAIFTIHYTQAILENN
LPSEMASKINLVDLAGSERADPSYCKDRIAEGANINKSLVTLGIVISTLAQNSQVFSSCQ
SLNSSVSNGGDSGILSSPSGTSSGGAPSRRQSYIPYRDSVLTWLLKDSLGGNSKTIMVAT
VSPAHTSYSETMSTLRYASSAKNIINKPRVNEDANLKLIRELREEIERLKALLLSFELRN
FSSLSDENLKELVLQNELKIDQLTKDWTQKWNDWQALMEHYSVDINRRRAGVVIDSSLPH
LMALEDDVLSTGVVLYHLKEGTTKIGRIDSDQEQDIVLQGQWIERDHCTITSACGVVVLR
PARGARCTVNGREVTASCRLTQGAVITLGKAQKFRFNHPAEAAVLRQRRQVGEAAAGRGS
LEWLDLDGDLAASRLGLSPLLWKERRALEEQCDEDHQTPRDGETSHRAQIQQQQSYVEDL
RHQILAEEIRAAKELEFDQAWISQQIKENQQCLLREETWLASLQQQQQEDQVAEKELEAS
VALDAWLQTDPEIQPSPFVQSQKRVVHLQLLRRHTLRAAERNVRRKKVSFQLERIIKKQR
LLEAQKRLEKLTTLCWLQDDSTQEPPYQVLSPDATVPRPPCRSKLTSCSSLSPQRLCSKH
MPQLHSIFLSWDPSTTLPPRPDPTHQTSEKTSSEEHLPQAASYPARTGCLRKNGLHSSGH
GQPCTARAALARKGASAPDACLTMSPNSVGIQEMEMGVKQPHQMVSQGLASLRKSANKLK
PRHEPKIFTSTTQTRGAKGLADPSHTQAGWRKEGNLGTHKAAKGASCNSLYPHGPRQTAG
HGKAVKTFWTEYKPPSPSRASKRHQRVLATRVRNITKKSSHLPLGSPLKRQQNTRDPDTM
VPLTDFSPVMDHSREKDNDLSDTDSNYSLDSLSCVYAKALIEPLKPEERKWDFPEPENSE
SDDSQLSEDSLAEKRYQSPKNRLGGNRPTNNRGQPRTRTRASVRGFTAASDSDLLAQTHR
SFSLDSLIDAEEELGEDQQEEPFPGSADEIPTETFWHLEDSSLPVMDQEAICRLGPINYR
TAARLDAVLPMSSSFYLDPQFQPHCELQPHCELQPHCELQPHCEQAESQVEPSYSEQADS
LQGMQLSRESPLMSMDSWFSCDSKINPSSPPGIVGSLCPSPDMQEFHSCKGERPGYWPNT
EELKPSDAETVLPYSSKLHQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7wrgA	0.235	0.398	4.638E-45	812	0.141	0.244	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
2	PDB:7wrgB	0.226	0.398	2.747E-44	783	0.139	0.248	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
3	AFDB:Q6S002	0.247	0.278	2.353E-38	1238	0.189	0.213	Q6S002.pdb.gz	KIF10_DICDI Kinesin-related protein 10 OS=Dictyostelium discoideum OX=44689 GN=kif10 PE=3 SV=1
4	AFDB:Q6S000	0.235	0.220	1.797E-31	1499	0.168	0.157	Q6S000.pdb.gz	KIF12_DICDI Kinesin-related protein 12 OS=Dictyostelium discoideum OX=44689 GN=kif12 PE=3 SV=1
5	AFDB:Q7TNC6	0.221	0.149	1.493E-22	2112	0.166	0.110	Q7TNC6.pdb.gz	KI26B_MOUSE Kinesin-like protein KIF26B OS=Mus musculus OX=10090 GN=Kif26b PE=1 SV=3
6	PDB:4h1gA	0.196	0.396	6.359E-21	670	0.078	0.163	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
7	AFDB:Q9ULI4	0.218	0.165	2.407E-19	1882	0.166	0.124	Q9ULI4.pdb.gz	KI26A_HUMAN Kinesin-like protein KIF26A OS=Homo sapiens OX=9606 GN=KIF26A PE=1 SV=3
8	AFDB:Q52KG5	0.218	0.164	4.356E-19	1881	0.180	0.134	Q52KG5.pdb.gz	KI26A_MOUSE Kinesin-like protein KIF26A OS=Mus musculus OX=10090 GN=Kif26a PE=1 SV=2
9	PDB:2ff4A	0.064	0.230	9.786E-7	379	0.019	0.069	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
10	PDB:2kb3A	0.063	0.535	5.578E-5	143	0.016	0.161	2kb3A.pdb.gz
11	PDB:7dvqX	0.064	0.521	9.563E-5	156	0.014	0.128	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
12	AFDB:Q95RC8	0.069	0.075	1.372E-3	1280	0.087	0.095	Q95RC8.pdb.gz	Q95RC8_DROME LD44171p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
13	AFDB:Q1G7G9	0.046	0.043	1.528E-3	1523	0.119	0.109	Q1G7G9.pdb.gz	TALD3_CHICK TALPID3 protein OS=Gallus gallus OX=9031 GN=TALPID3 PE=2 SV=2
14	AFDB:Q9R0I7	0.056	0.056	3.080E-3	1386	0.096	0.097	Q9R0I7.pdb.gz	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2
15	AFDB:B7SY83	0.070	0.067	3.620E-3	1477	0.102	0.097	B7SY83.pdb.gz	PS1_ARATH FHA domain-containing protein PS1 OS=Arabidopsis thaliana OX=3702 GN=PS1 PE=2 SV=1
16	AFDB:Q586D8	0.180	0.167	4.740E-3	1522	0.046	0.043	Q586D8.pdb.gz	Q586D8_TRYB2 Present in the outer mitochondrial membrane proteome 22 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.135 PE=4 SV=1
17	PDB:5w3sA	0.042	0.086	2.602E-2	485	0.019	0.054	5w3sA.pdb.gz	Cryo-electron microscopy structure of the lysosomal calcium-permeable channel TRPML3.
18	PDB:2kfuA	0.064	0.441	4.709E-2	162	0.019	0.167	2kfuA.pdb.gz
19	PDB:6aygA	0.042	0.089	7.247E-2	439	0.017	0.055	6aygA.pdb.gz
20	PDB:5j6hA	0.035	0.123	1.115E-1	275	0.011	0.058	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AVY7	0.0	601	1312	0.231	0.246	KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus OX=10090 GN=Kif16b PE=1 SV=1
2	Q96L93	0.0	601	1317	0.221	0.235	KI16B_HUMAN Kinesin-like protein KIF16B OS=Homo sapiens OX=9606 GN=KIF16B PE=1 SV=2
3	Q9P2P6	0.0	2910	4700	1.000	0.298	STAR9_HUMAN StAR-related lipid transfer protein 9 OS=Homo sapiens OX=9606 GN=STARD9 PE=1 SV=3
4	Q9VB25	1.61e-168	540	1265	0.206	0.228	KL98A_DROME Kinesin-like protein Klp98A OS=Drosophila melanogaster OX=7227 GN=Klp98A PE=1 SV=2
5	O43896	6.49e-128	426	1103	0.189	0.239	KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3
6	F1QJ64	2.38e-127	426	1161	0.183	0.220	F1QJ64_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
7	O35071	6.76e-125	418	1100	0.189	0.240	KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus OX=10090 GN=Kif1c PE=1 SV=2
8	A0A8I6A6V5	8.25e-125	428	1697	0.187	0.154	A0A8I6A6V5_RAT Kinesin family member 1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=1
9	Q12756	9.64e-125	428	1690	0.187	0.155	KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens OX=9606 GN=KIF1A PE=1 SV=2
10	P33173	1.04e-124	428	1695	0.187	0.155	KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus OX=10090 GN=Kif1a PE=1 SV=2
11	A1ZAJ2	2.21e-124	427	1670	0.207	0.174	KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1
12	E9QDE5	6.94e-124	426	1763	0.183	0.145	E9QDE5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
13	F1QBV5	7.14e-124	426	1770	0.183	0.145	F1QBV5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
14	O35787	3.75e-123	413	1097	0.189	0.241	KIF1C_RAT Kinesin-like protein KIF1C OS=Rattus norvegicus OX=10116 GN=Kif1c PE=1 SV=1
15	F1M4A4	5.79e-123	423	1707	0.189	0.155	KIF1A_RAT Kinesin-like protein KIF1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=3
16	Q9NQT8	1.62e-121	420	1826	0.179	0.137	KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2
17	A0A0B4LGK5	7.70e-119	413	1913	0.167	0.122	A0A0B4LGK5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
18	A0A0B4KFR5	7.91e-119	413	1957	0.167	0.120	A0A0B4KFR5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
19	A1ZA18	7.92e-119	413	1921	0.167	0.122	A1ZA18_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
20	A4UZI0	8.36e-119	413	1899	0.167	0.123	A4UZI0_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	0.012	27.2	FHA domain
2	PF00225 Kinesin	1.8e-96	334.6	Kinesin motor domain
3	PF16183 Kinesin_assoc	0.00015	33.5	Kinesin-associated
4	PF16796 Microtub_bd	7e-18	76.5	Microtubule binding
5	PF16697 Yop-YscD_cpl	0.002	29.7	Inner membrane component of T3SS, cytoplasmic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290607

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000462349	0.676	StAR-related lipid transfer protein 6
2	9606.ENSP00000363727	0.666	StAR-related lipid transfer protein 8
3	9606.ENSP00000351346	0.660	Vacuolar protein sorting-associated protein 13B
4	9606.ENSP00000215882	0.644	Tricarboxylate transport protein, mitochondrial
5	9606.ENSP00000326817	0.641	Leucine-rich repeat-containing protein 57
6	9606.ENSP00000355374	0.618	Oxidative stress-induced growth inhibitor 1
7	9606.ENSP00000347931	0.614	Pecanex-like 3 (Drosophila)
8	9606.ENSP00000220496	0.610	DnaJ homolog subfamily C member 17
9	9606.ENSP00000261609	0.607	E3 ubiquitin-protein ligase HERC2
10	9606.ENSP00000338785	0.607	StAR-related lipid transfer protein 13
11	9606.ENSP00000347498	0.607	Abscission/NoCut checkpoint regulator
12	9606.ENSP00000305995	0.597	Phosphoglycerate kinase 2
13	9606.ENSP00000360366	0.594	Acyl-coenzyme A thioesterase 11
14	9606.ENSP00000350719	0.591	Nesprin-2
15	9606.ENSP00000268896	0.565	Phosphatidylcholine transfer protein
16	9606.ENSP00000348564	0.559	Codanin-1
17	9606.ENSP00000438553	0.555	Histone H2A.J
18	9606.ENSP00000346027	0.552	60S ribosomal protein L21
19	9606.ENSP00000338030	0.551	StAR-related lipid transfer protein 7, mitochondrial
20	9606.ENSP00000335247	0.544	START domain-containing protein 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003777	1.000	microtubule motor activity
GO:0008017	0.992	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0007017	0.855	microtubule-based process
GO:0007051	0.840	spindle organization
GO:0007059	0.814	chromosome segregation
GO:0051225	0.802	spindle assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0043227	0.997	membrane-bounded organelle
GO:0005737	0.965	cytoplasm
GO:0043232	0.950	intracellular non-membrane-bounded organelle
GO:0043231	0.949	intracellular membrane-bounded organelle
GO:0015630	0.702	microtubule cytoskeleton
GO:0005634	0.657	nucleus
GO:0005815	0.592	microtubule organizing center
GO:0005814	0.541	centriole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]