StarFunc result for job id Q9P2Q2

User Input

>input (1039 residues)
MAVQLVPDSALGLLMMTEGRRCQVHLLDDRKLELLVQPKLLAKELLDLVASHFNLKEKEY
FGIAFTDETGHLNWLQLDRRVLEHDFPKKSGPVVLYFCVRFYIESISYLKDNATIELFFL
NAKSCIYKELIDVDSEVVFELASYILQEAKGDFSSNEVVRSDLKKLPALPTQALKEHPSL
AYCEDRVIEHYKKLNGQTRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWLGLSYKGI
FQYDYHDKVKPRKIFQWRQLENLYFREKKFSVEVHDPRRASVTRRTFGHSGIAVHTWYAC
PALIKSIWAMAISQHQFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGK
IISGSSGSLLSSGSQESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKKLCLREAELT
GKLPVEYPLDPGEEPPIVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAAR
RLASDPNVSKKLKKQRKTSYLNALKKLQEIENAINENRIKSGKKPTQRASLIIDDGNIAS
EDSSLSDALVLEDEDSQVTSTISPLHSPHKGLPPRPPSHNRPPPPQSLEGLRQMHYHRND
YDKSPIKPKMWSESSLDEPYEKVKKRSSHSHSSSHKRFPSTGSCAEAGGGSNSLQNSPIR
GLPHWNSQSSMPSTPDLRVRSPHYVHSTRSVDISPTRLHSLALHFRHRSSSLESQGKLLG
SENDTGSPDFYTPRTRSSNGSDPMDDCSSCTSHSSSEHYYPAQMNANYSTLAEDSPSKAR
QRQRQRQRAAGALGSASSGSMPNLAARGGAGGAGGAGGGVYLHSQSQPSSQYRIKEYPLY
IEGGATPVVVRSLESDQEGHYSVKAQFKTSNSYTAGGLFKESWRGGGGDEGDTGRLTPSR
SQILRTPSLGREGAHDKGAGRAAVSDELRQWYQRSTASHKEHSRLSHTSSTSSDSGSQYS
TSSQSTFVAHSRVTRMPQMCKATSAALPQSQRSSTPSSEIGATPPSSPHHILTWQTGEAT
ENSPILDGSESPPHQSTDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2Q2	1.000	1.000	0.000	1039	1.000	1.000	Q9P2Q2.pdb.gz	FRM4A_HUMAN FERM domain-containing protein 4A OS=Homo sapiens OX=9606 GN=FRMD4A PE=1 SV=3
2	AFDB:Q920B0	0.464	0.466	7.857E-81	1035	0.468	0.470	Q920B0.pdb.gz	FRM4B_MOUSE FERM domain-containing protein 4B OS=Mus musculus OX=10090 GN=Frmd4b PE=1 SV=2
3	PDB:4rm8A	0.263	0.695	1.013E-22	368	0.087	0.245	4rm8A.pdb.gz
4	AFDB:Q3KP66	0.077	0.112	1.431E-15	663	0.188	0.294	Q3KP66.pdb.gz	INAVA_HUMAN Innate immunity activator protein OS=Homo sapiens OX=9606 GN=INAVA PE=1 SV=2
5	AFDB:Q07436	0.248	0.185	6.946E-14	1427	0.163	0.118	Q07436.pdb.gz	EXPA_DROME Protein expanded OS=Drosophila melanogaster OX=7227 GN=ex PE=1 SV=3
6	AFDB:Q96HB5	0.111	0.160	4.384E-12	630	0.149	0.246	Q96HB5.pdb.gz	CC120_HUMAN Coiled-coil domain-containing protein 120 OS=Homo sapiens OX=9606 GN=CCDC120 PE=1 SV=1
7	AFDB:Q5SYB0	0.247	0.167	6.330E-12	1578	0.147	0.097	Q5SYB0.pdb.gz	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
8	AFDB:D3ZW88	0.248	0.191	8.228E-12	1371	0.157	0.119	D3ZW88.pdb.gz	D3ZW88_RAT FERM and PDZ domain containing 1 OS=Rattus norvegicus OX=10116 GN=Frmpd1 PE=4 SV=3
9	AFDB:Q14CM0	0.256	0.204	1.195E-10	1322	0.137	0.107	Q14CM0.pdb.gz	FRPD4_HUMAN FERM and PDZ domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FRMPD4 PE=1 SV=1
10	AFDB:D4A3K7	0.253	0.158	9.747E-10	1705	0.139	0.084	D4A3K7.pdb.gz	D4A3K7_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=2
11	PDB:6r9tA	0.139	0.071	1.610E-6	2185	0.039	0.019	6r9tA.pdb.gz
12	PDB:7c3mA	0.221	0.379	7.372E-6	577	0.046	0.083	7c3mA.pdb.gz
13	AFDB:F2Z3U3	0.108	0.092	8.581E-5	1266	0.120	0.099	F2Z3U3.pdb.gz	F2Z3U3_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=2
14	PDB:6pyuA	0.072	0.080	4.681E-3	930	0.019	0.022	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
15	PDB:3dbhI	0.072	0.688	5.774E-3	86	0.010	0.116	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
16	PDB:7wjiA	0.072	0.044	6.085E-3	1763	0.024	0.014	7wjiA.pdb.gz
17	PDB:6u3eA	0.086	0.182	7.122E-3	397	0.031	0.081	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
18	PDB:7lq1A	0.071	0.077	7.910E-3	950	0.020	0.022	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
19	PDB:5swpA	0.078	0.076	9.758E-3	1060	0.028	0.027	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
20	PDB:6mdhA	0.067	0.428	1.084E-2	149	0.011	0.074	6mdhA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BIE6	0.0	2041	1020	0.960	0.977	FRM4A_MOUSE FERM domain-containing protein 4A OS=Mus musculus OX=10090 GN=Frmd4a PE=1 SV=2
2	Q920B0	0.0	791	1035	0.460	0.462	FRM4B_MOUSE FERM domain-containing protein 4B OS=Mus musculus OX=10090 GN=Frmd4b PE=1 SV=2
3	Q9P2Q2	0.0	2142	1039	1.000	1.000	FRM4A_HUMAN FERM domain-containing protein 4A OS=Homo sapiens OX=9606 GN=FRMD4A PE=1 SV=3
4	Q9Y2L6	0.0	819	1034	0.466	0.468	FRM4B_HUMAN FERM domain-containing protein 4B OS=Homo sapiens OX=9606 GN=FRMD4B PE=1 SV=4
5	Q3KP66	5.04e-43	169	663	0.132	0.207	INAVA_HUMAN Innate immunity activator protein OS=Homo sapiens OX=9606 GN=INAVA PE=1 SV=2
6	Q7TN12	2.72e-40	161	663	0.128	0.201	INAVA_MOUSE Innate immunity activator protein OS=Mus musculus OX=10090 GN=Inava PE=2 SV=1
7	P26038	8.22e-35	143	577	0.090	0.161	MOES_HUMAN Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3
8	V9HWC0	8.22e-35	143	577	0.090	0.161	V9HWC0_HUMAN Epididymis luminal protein 70 OS=Homo sapiens OX=9606 GN=HEL70 PE=2 SV=1
9	A0A0G2K095	2.44e-34	142	580	0.085	0.152	A0A0G2K095_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=1 SV=2
10	Q5TZG5	2.68e-34	142	583	0.090	0.160	Q5TZG5_DANRE Ezrin OS=Danio rerio OX=7955 GN=ezr PE=1 SV=1
11	O35763	2.96e-34	142	577	0.089	0.159	MOES_RAT Moesin OS=Rattus norvegicus OX=10116 GN=Msn PE=1 SV=3
12	Q66I42	3.25e-34	141	579	0.086	0.154	Q66I42_DANRE Moesin OS=Danio rerio OX=7955 GN=rdx PE=1 SV=1
13	P26041	3.68e-34	141	577	0.089	0.159	MOES_MOUSE Moesin OS=Mus musculus OX=10090 GN=Msn PE=1 SV=3
14	Q5PQK5	4.07e-34	141	583	0.085	0.151	Q5PQK5_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=4 SV=1
15	P26043	4.46e-34	141	583	0.085	0.151	RADI_MOUSE Radixin OS=Mus musculus OX=10090 GN=Rdx PE=1 SV=3
16	Q5WQV5	4.66e-34	141	583	0.085	0.151	Q5WQV5_RAT Radixin OS=Rattus norvegicus OX=10116 PE=1 SV=1
17	B0YJ88	5.15e-34	141	583	0.085	0.151	B0YJ88_HUMAN Radixin OS=Homo sapiens OX=9606 GN=RDX PE=2 SV=1
18	P35241	5.15e-34	141	583	0.085	0.151	RADI_HUMAN Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1
19	E9PT65	5.86e-34	141	604	0.085	0.146	E9PT65_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=1 SV=3
20	A0A8I5ZR70	7.01e-34	140	582	0.085	0.151	A0A8I5ZR70_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11819 CUPID	2.4e-56	200.9	Cytohesin Ubiquitin Protein Inducing Domain
2	PF09380 FERM_C	1.4e-20	84.9	FERM C-terminal PH-like domain
3	PF00373 FERM_M	1.9e-15	68.6	FERM central domain
4	PF09379 FERM_N	2.5e-15	67.4	FERM N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350032

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354398	0.887	Cytohesin-1
2	9606.ENSP00000297044	0.766	Cytohesin-3
3	9606.ENSP00000298316	0.721	ADP-ribosylation factor 6
4	9606.ENSP00000351618	0.704	Partitioning defective 3 homolog B
5	9606.ENSP00000308515	0.670	dephospho-CoA kinase domain containing
6	9606.ENSP00000295006	0.667	Calpain-2 catalytic subunit
7	9606.ENSP00000420659	0.650	Kelch-like protein 29
8	9606.ENSP00000379898	0.640	ADP-ribosylation factor-like protein 4A
9	9606.ENSP00000339754	0.593	ADP-ribosylation factor-like protein 4C
10	9606.ENSP00000258787	0.574	Unconventional myosin-Ig
11	9606.ENSP00000056233	0.570	Nuclear factor erythroid 2-related factor 3
12	9606.ENSP00000278601	0.556	Uncharacterized protein C11orf52
13	9606.ENSP00000293662	0.549	General receptor for phosphoinositides 1-associated scaffold protein
14	9606.ENSP00000302657	0.548	Protein ABHD15
15	9606.ENSP00000323555	0.543	Olfactory receptor 8K3
16	9606.ENSP00000323816	0.525	Aryl hydrocarbon receptor repressor
17	9606.ENSP00000314649	0.511	Succinate-semialdehyde dehydrogenase, mitochondrial
18	9606.ENSP00000373420	0.501	RUN and FYVE domain containing 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060090	0.991	molecular adaptor activity
GO:0030674	0.823	protein-macromolecule adaptor activity
GO:0019899	0.302	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.989	regulation of cellular process
GO:0060341	0.976	regulation of cellular localization
GO:0051046	0.971	regulation of secretion
GO:0051223	0.970	regulation of protein transport
GO:0009987	0.966	cellular process
GO:0050708	0.927	regulation of protein secretion
GO:0048518	0.815	positive regulation of biological process
GO:0048522	0.798	positive regulation of cellular process
GO:1904951	0.596	positive regulation of establishment of protein localization
GO:0051050	0.435	positive regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043226	0.956	organelle
GO:0030054	0.900	cell junction
GO:0016020	0.858	membrane
GO:0043229	0.852	intracellular organelle
GO:0043227	0.797	membrane-bounded organelle
GO:0043231	0.794	intracellular membrane-bounded organelle
GO:0005829	0.773	cytosol
GO:0070161	0.488	anchoring junction
GO:0005911	0.440	cell-cell junction
GO:0043296	0.324	apical junction complex
GO:0005923	0.308	bicellular tight junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]