StarFunc result for job id Q9P2R3

User Input

>input (1169 residues)
MAEEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCALLAAQANKESSSESFISRLLAIVAD
LYEQEQYSDLKIKVGDRHISAHKFVLAARSDSWSLANLSSTKELDLSDANPEVTMTMLRW
IYTDELEFREDDVFLTELMKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNAS
TLMNYCAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYLIE
MDSQLPGKLNEADHNGDLALDLALSRRLESIATTLVSHKADVDMVDKSGWSLLHKGIQRG
DLFAATFLIKNGAFVNAATLGAQETPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANP
NMQDSKGRTPLHVSIMAGNEYVFSQLLQCKQLDLELKDHEGSTALWLAVQHITVSSDQSV
NPFEDVPVVNGTSFDENSFAARLIQRGSHTDAPDTATGNCLLQRAAGAGNEAAALFLATN
GAHVNHRNKWGETPLHTACRHGLANLTAELLQQGANPNLQTEEALPLPKEAASLTSLADS
VHLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTG
MHTIAAQLLGSGAAINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVRTQDGETALQ
LAIRNQLPLVVDAICTRGADMSVPDEKGNPPLWLALANNLEDIASTLVRHGCDATCWGPG
PGGCLQTLLHRAIDENNEPTACFLIRSGCDVNSPRQPGANGEGEEEARDGQTPLHLAASW
GLEETVQCLLEFGANVNAQDAEGRTPIHVAISSQHGVIIQLLVSHPDIHLNVRDRQGLTP
FACAMTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNSR
VQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLE
NGVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKEN
AAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNI
FNYQVATKQLLFRLLDMLSKEPPWCDGSYCYECTARFGVTTRKHHCRHCGRLLCHKCSTK
EIPIIKFDLNKPVRVCNICFDVLTLGGVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q810B6	0.692	0.692	0.000	1169	0.950	0.950	Q810B6.pdb.gz	ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus OX=10090 GN=Ankfy1 PE=1 SV=2
2	AFDB:Q7PLP5	0.662	0.686	3.044E-89	1124	0.418	0.435	Q7PLP5.pdb.gz	Q7PLP5_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=BEST:GM10035 PE=1 SV=1
3	AFDB:O15084	0.231	0.252	1.550E-33	1053	0.191	0.212	O15084.pdb.gz	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
4	AFDB:Q8NB46	0.230	0.248	2.054E-33	1076	0.210	0.228	Q8NB46.pdb.gz	ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3
5	AFDB:P97582	0.235	0.312	3.753E-33	843	0.175	0.243	P97582.pdb.gz	P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
6	AFDB:Q9NCP8	0.245	0.247	7.433E-33	1159	0.182	0.184	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
7	AFDB:Q0KIE7	0.232	0.182	8.730E-33	1549	0.192	0.145	Q0KIE7.pdb.gz	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
8	AFDB:G5E8K5	0.245	0.159	2.114E-32	1961	0.186	0.111	G5E8K5.pdb.gz	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
9	AFDB:P16157	0.230	0.153	2.483E-32	1881	0.191	0.119	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
10	AFDB:Q8N8A2	0.216	0.248	5.119E-32	993	0.178	0.209	Q8N8A2.pdb.gz	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
11	PDB:8cs9A	0.231	0.320	1.144E-31	796	0.181	0.266	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:5vkqA	0.212	0.174	5.954E-24	1499	0.187	0.146	5vkqA.pdb.gz
13	PDB:4oauC	0.159	0.257	7.087E-11	692	0.114	0.192	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:6aunA	0.161	0.282	8.044E-8	618	0.064	0.121	6aunA.pdb.gz
15	PDB:2dvwA	0.145	0.599	1.155E-7	229	0.051	0.262	2dvwA.pdb.gz
16	PDB:7mk2A	0.124	0.364	1.871E-7	354	0.059	0.195	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
17	PDB:1wg0A	0.162	0.609	7.050E-7	243	0.053	0.255	1wg0A.pdb.gz
18	PDB:6v9hC	0.126	0.399	7.954E-7	270	0.053	0.230	6v9hC.pdb.gz
19	PDB:6jd6B	0.135	0.763	2.765E-6	192	0.039	0.240	6jd6B.pdb.gz
20	PDB:6mwqA	0.126	0.290	2.424E-5	493	0.050	0.118	6mwqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8Y582	0.0	891	1122	0.423	0.441	A8Y582_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=GM10035 PE=1 SV=1
2	Q5BI36	0.0	691	843	0.322	0.446	Q5BI36_DROME LD32875p OS=Drosophila melanogaster OX=7227 GN=CG41099 PE=2 SV=1
3	Q7PLP4	0.0	889	1111	0.422	0.444	Q7PLP4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG41099 PE=1 SV=1
4	Q7PLP5	0.0	892	1124	0.423	0.440	Q7PLP5_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=BEST:GM10035 PE=1 SV=1
5	Q810B6	0.0	2289	1169	0.950	0.950	ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus OX=10090 GN=Ankfy1 PE=1 SV=2
6	Q8SY24	0.0	696	861	0.328	0.445	Q8SY24_DROME RE06111p OS=Drosophila melanogaster OX=7227 GN=CG17419 PE=2 SV=1
7	Q9P2R3	0.0	2415	1169	1.000	1.000	ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2
8	X2JCM1	1.03e-55	216	11634	0.187	0.019	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
9	M9MRX4	1.69e-55	215	13559	0.187	0.016	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
10	Q17490	1.54e-53	209	6994	0.179	0.030	Q17490_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=2
11	Q8MQG0	9.20e-52	202	1841	0.182	0.116	Q8MQG0_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
12	G5ECZ1	1.10e-51	202	1867	0.182	0.114	G5ECZ1_CAEEL AO66 ankyrin OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
13	Q9NCP8	5.89e-51	199	1159	0.185	0.186	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
14	M9PHP8	4.70e-50	196	1309	0.185	0.165	M9PHP8_DROME Ankyrin 2, isoform W OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
15	Q7KU95	6.50e-50	196	2404	0.181	0.088	Q7KU95_DROME Ankyrin 2, isoform M OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
16	X2JGD3	6.66e-50	196	2566	0.185	0.084	X2JGD3_DROME Ankyrin 2, isoform Y OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	A8JNM4	1.03e-49	196	2532	0.181	0.084	A8JNM4_DROME Ankyrin 2, isoform G OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
18	M9PEN3	4.41e-49	194	4373	0.178	0.048	M9PEN3_DROME Ankyrin 2, isoform V OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	M9MRS5	4.71e-49	194	4496	0.181	0.047	M9MRS5_DROME Ankyrin 2, isoform R OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	X2JC49	5.76e-49	194	4233	0.178	0.049	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	4.3e-58	202.7	Ankyrin repeat
2	PF12796 Ank_2	1.1e-75	261.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	5e-60	203.2	Ankyrin repeat
4	PF13637 Ank_4	5.5e-64	223.0	Ankyrin repeats (many copies)
5	PF13857 Ank_5	9.7e-48	170.9	Ankyrin repeats (many copies)
6	PF07707 BACK	2	19.9	BTB And C-terminal Kelch
7	PF00651 BTB	4.5e-12	57.5	BTB/POZ domain
8	PF01363 FYVE	8.7e-12	56.3	FYVE zinc finger
9	PF20265 LARA_dom	2.1e+02	13.6	ATPase, RavA, LARA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000459943

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479153	0.959	EH domain-containing protein 1
2	9606.ENSP00000320821	0.913	Kinesin-like protein KIF1C
3	9606.ENSP00000273047	0.904	Ras-related protein Rab-5A
4	9606.ENSP00000264414	0.826	Cullin-3
5	9606.ENSP00000445408	0.753	Rab GTPase-binding effector protein 1
6	9606.ENSP00000354669	0.727	Ubiquitin carboxyl-terminal hydrolase MINDY-1
7	9606.ENSP00000473565	0.727	DENN domain-containing protein 4C
8	9606.ENSP00000215957	0.718	MICAL-like protein 1
9	9606.ENSP00000286760	0.718	WASP homolog-associated protein with actin, membranes and microtubules
10	9606.ENSP00000299138	0.711	Vacuolar protein sorting-associated protein 35
11	9606.ENSP00000297338	0.707	Double-strand-break repair protein rad21 homolog
12	9606.ENSP00000253699	0.695	Rabenosyn-5
13	9606.ENSP00000262291	0.664	Vacuole membrane protein 1
14	9606.ENSP00000355759	0.657	Poly [ADP-ribose] polymerase 1
15	9606.ENSP00000304669	0.654	Catenin alpha-1
16	9606.ENSP00000403701	0.650	Beta-arrestin-2
17	9606.ENSP00000261889	0.646	Sorting nexin-1
18	9606.ENSP00000384638	0.645	Catenin alpha-2
19	9606.ENSP00000362480	0.639	Vacuolar protein sorting-associated protein 26A
20	9606.ENSP00000300584	0.606	TBC1 domain family member 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005543	0.998	phospholipid binding
GO:0051020	0.827	GTPase binding
GO:0035091	0.822	phosphatidylinositol binding
GO:0031267	0.801	small GTPase binding
GO:1901981	0.641	phosphatidylinositol phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0051179	0.986	localization
GO:0050794	0.978	regulation of cellular process
GO:0051234	0.956	establishment of localization
GO:0006810	0.954	transport
GO:0016482	0.939	cytosolic transport
GO:0016050	0.879	vesicle organization
GO:0048193	0.871	Golgi vesicle transport
GO:0016197	0.870	endosomal transport
GO:0048284	0.858	organelle fusion
GO:0030100	0.852	regulation of endocytosis
GO:0007041	0.807	lysosomal transport
GO:0048518	0.805	positive regulation of biological process
GO:0061025	0.803	membrane fusion
GO:0006892	0.798	post-Golgi vesicle-mediated transport
GO:0006906	0.790	vesicle fusion
GO:0048522	0.720	positive regulation of cellular process
GO:0051050	0.538	positive regulation of transport
GO:0006896	0.515	Golgi to vacuole transport
GO:0042147	0.323	retrograde transport, endosome to Golgi

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0031982	0.977	vesicle
GO:0031090	0.965	organelle membrane
GO:0031410	0.956	cytoplasmic vesicle
GO:0098588	0.946	bounding membrane of organelle
GO:0010008	0.942	endosome membrane
GO:0005829	0.882	cytosol
GO:0005634	0.729	nucleus
GO:0070013	0.706	intracellular organelle lumen
GO:0031981	0.613	nuclear lumen
GO:0005654	0.455	nucleoplasm
GO:0005886	0.438	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]