StarFunc result for job id Q9P2R6

User Input

>input (1566 residues)
MTADKDKDKDKEKDRDRDRDREREKRDKARESENSRPRRSCTLEGGAKNYAESDHSEDED
NDNNSATAEESTKKNKKKPPKKKSRYERTDTGEITSYITEDDVVYRPGDCVYIESRRPNT
PYFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHL
LMNVKWYYRQSEVPDSVYQHLVQDRHNENDSGRELVITDPVIKNRELFISDYVDTYHAAA
LRGKCNISHFSDIFAAREFKARVDSFFYILGYNPETRRLNSTQGEIRVGPSHQAKLPDLQ
PFPSPDGDTVTQHEELVWMPGVNDCDLLMYLRAARSMAAFAGMCDGGSTEDGCVAASRDD
TTLNALNTLHESGYDAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRK
ELLPNKETGELITFYYYWKKTPEAASSRAHRRHRRQAVFRRIKTRTASTPVNTPSRPPSS
EFLDLSSASEDDFDSEDSEQELKGYACRHCFTTTSKDWHHGGRENILLCTDCRIHFKKYG
ELPPIEKPVDPPPFMFKPVKEEDDGLSGKHSMRTRRSRGSMSTLRSGRKKQPASPDGRTS
PINEDIRSSGRNSPSAASTSSNDSKAETVKKSAKKVKEEASSPLKSNKRQREKVASDTEE
ADRTSSKKTKTQEISRPNSPSEGEGESSDSRSVNDEGSSDPKDIDQDNRSTSPSIPSPQD
NESDSDSSAQQQMLQAQPPALQAPTGVTPAPSSAPPGTPQLPTPGPTPSATAVPPQGSPT
ASQAPNQPQAPTAPVPHTHIQQAPALHPQRPPSPHPPPHPSPHPPLQPLTGSAGQPSAPS
HAQPPLHGQGPPGPHSLQAGPLLQHPGPPQPFGLPPQASQGQAPLGTSPAAAYPHTSLQL
PASQSALQSQQPPREQPLPPAPLAMPHIKPPPTTPIPQLPAPQAHKHPPHLSGPSPFSMN
ANLPPPPALKPLSSLSTHHPPSAHPPPLQLMPQSQPLPSSPAQPPGLTQSQNLPPPPASH
PPTGLHQVAPQPPFAQHPFVPGGPPPITPPTCPSTSTPPAGPGTSAQPPCSGAAASGGSI
AGGSSCPLPTVQIKEEALDDAEEPESPPPPPRSPSPEPTVVDTPSHASQSARFYKHLDRG
YNSCARTDLYFMPLAGSKLAKKREEAIEKAKREAEQKAREEREREKEKEKERERERERER
EAERAAKASSSAHEGRLSDPQLSGPGHMRPSFEPPPTTIAAVPPYIGPDTPALRTLSEYA
RPHVMSPTNRNHPFYMPLNPTDPLLAYHMPGLYNVDPTIRERELREREIREREIRERELR
ERMKPGFEVKPPELDPLHPAANPMEHFARHSALTIPPTAGPHPFASFHPGLNPLERERLA
LAGPQLRPEMSYPDRLAAERIHAERMASLTSDPLARLQMFNVTPHHHQHSHIHSHLHLHQ
QDPLHQGSAGPVHPLVDPLTAGPHLARFPYPPGTLPNPLLGQPPHEHEMLRHPVFGTPYP
RDLPGAIPPPMSAAHQLQAMHAQSAELQRLAMEQQWLHGHPHMHGGHLPSQEDYYSRLKK
EGDKQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7F226	0.391	0.398	0.000	1531	0.767	0.784	E7F226.pdb.gz
2	AFDB:Q9P2R6	1.000	1.000	0.000	1566	1.000	1.000	Q9P2R6.pdb.gz	RERE_HUMAN Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens OX=9606 GN=RERE PE=1 SV=2
3	PDB:7aoaD	0.106	0.411	1.052E-18	343	0.062	0.283	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
4	AFDB:M9PHT1	0.098	0.080	2.042E-17	2007	0.246	0.192	M9PHT1.pdb.gz	M9PHT1_DROME Grunge, isoform J OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
5	AFDB:F4JCS8	0.072	0.070	1.679E-9	1613	0.145	0.141	F4JCS8.pdb.gz	F4JCS8_ARATH Protein SUO OS=Arabidopsis thaliana OX=3702 GN=SUO PE=1 SV=1
6	PDB:5z8lA	0.069	0.487	2.476E-6	204	0.022	0.172	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
7	AFDB:Q70HU3	0.045	0.056	2.753E-6	1135	0.126	0.174	Q70HU3.pdb.gz	Q70HU3_DROME PNUTSDm protein OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=2 SV=1
8	AFDB:Q60974	0.039	0.028	2.902E-5	2453	0.128	0.082	Q60974.pdb.gz	NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus OX=10090 GN=Ncor1 PE=1 SV=1
9	AFDB:Q9VAS9	0.048	0.034	7.094E-4	2417	0.121	0.079	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
10	AFDB:F4HS99	0.049	0.045	1.111E-3	1797	0.077	0.067	F4HS99.pdb.gz	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
11	AFDB:P34127	0.050	0.060	1.645E-3	1230	0.090	0.115	P34127.pdb.gz	MYBA_DICDI Myb-like protein A OS=Dictyostelium discoideum OX=44689 GN=mybA PE=4 SV=2
12	AFDB:A1Z9K8	0.031	0.031	4.774E-3	1871	0.142	0.119	A1Z9K8.pdb.gz	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
13	PDB:7vdvW	0.028	0.160	5.645E-1	248	0.015	0.093	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
14	PDB:7c4jB	0.029	0.108	1.464	395	0.013	0.053	7c4jB.pdb.gz
15	PDB:7dcoL	0.040	0.098	1.938	435	0.015	0.053	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
16	PDB:2fg8A	0.026	0.120	2.169	174	0.011	0.103	2fg8A.pdb.gz
17	PDB:3pzcB	0.016	0.070	2.566	276	0.003	0.018	3pzcB.pdb.gz	Homologs of aminoacyl-tRNA synthetases acylate carrier proteins and provide a link between ribosomal and nonribosomal peptide synthesis
18	PDB:3mf2A	0.016	0.065	2.714	299	0.003	0.017	3mf2A.pdb.gz	Homologs of aminoacyl-tRNA synthetases acylate carrier proteins and provide a link between ribosomal and nonribosomal peptide synthesis
19	PDB:7r5jW0	0.030	0.055	2.714	735	0.030	0.064	7r5jW0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:2hzqA	0.017	0.082	3.396	166	0.007	0.066	2hzqA.pdb.gz	Structural insight into the dual ligand specificity and mode of high density lipoprotein association of apolipoprotein d.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80TZ9	0.0	2435	1558	0.923	0.928	RERE_MOUSE Arginine-glutamic acid dipeptide repeats protein OS=Mus musculus OX=10090 GN=Rere PE=1 SV=3
2	Q9P2R6	0.0	3174	1566	1.000	1.000	RERE_HUMAN Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens OX=9606 GN=RERE PE=1 SV=2
3	P54258	8.86e-133	444	1183	0.206	0.273	ATN1_RAT Atrophin-1 OS=Rattus norvegicus OX=10116 GN=Atn1 PE=1 SV=1
4	P54259	1.54e-132	444	1190	0.206	0.271	ATN1_HUMAN Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3
5	Q86V38	1.57e-132	444	1191	0.206	0.270	Q86V38_HUMAN Atrophin 1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=1
6	O35126	3.44e-131	440	1175	0.195	0.260	ATN1_MOUSE Atrophin-1 OS=Mus musculus OX=10090 GN=Atn1 PE=1 SV=1
7	M9PES2	1.04e-63	243	1983	0.083	0.066	M9PES2_DROME Grunge, isoform I OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
8	Q86BH2	8.54e-62	236	1988	0.083	0.065	Q86BH2_DROME Grunge, isoform C OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
9	Q8IQA6	8.72e-62	236	1966	0.083	0.066	Q8IQA6_DROME Grunge, isoform A OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
10	Q7KUA8	8.75e-62	236	1985	0.083	0.065	Q7KUA8_DROME Grunge, isoform D OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
11	M9NDL9	8.76e-62	236	1988	0.083	0.065	M9NDL9_DROME Grunge, isoform F OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
12	Q9VSK5	8.82e-62	236	1985	0.083	0.065	Q9VSK5_DROME Grunge, isoform H OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=2
13	M9NE54	9.48e-62	236	2006	0.083	0.065	M9NE54_DROME Grunge, isoform G OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
14	Q8T9N4	9.86e-62	236	1985	0.083	0.065	Q8T9N4_DROME Transcriptional corepressor Atro OS=Drosophila melanogaster OX=7227 GN=Gug PE=2 SV=1
15	M9PHT1	1.10e-61	236	2007	0.083	0.065	M9PHT1_DROME Grunge, isoform J OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
16	Q9NHX6	3.94e-60	231	1966	0.082	0.065	Q9NHX6_DROME GRUNGE OS=Drosophila melanogaster OX=7227 GN=Gug PE=2 SV=1
17	Q09228	3.04e-57	219	1129	0.105	0.145	EGL27_CAEEL Egg-laying defective protein 27 OS=Caenorhabditis elegans OX=6239 GN=egl-27 PE=1 SV=2
18	Q924K8	1.56e-41	165	591	0.082	0.218	MTA3_MOUSE Metastasis-associated protein MTA3 OS=Mus musculus OX=10090 GN=Mta3 PE=1 SV=1
19	O94776	1.33e-40	163	668	0.068	0.160	MTA2_HUMAN Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1
20	F7F888	1.90e-40	162	670	0.068	0.160	F7F888_RAT Metastasis associated 1 family, member 2 OS=Rattus norvegicus OX=10116 GN=Mta2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03154 Atrophin-1	0	1836.8	Atrophin-1 family
2	PF01426 BAH	2.9e-10	51.5	BAH domain
3	PF01448 ELM2	1.3e-09	50.0	ELM2 domain
4	PF00320 GATA	1.5e-07	42.2	GATA zinc finger
5	PF00249 Myb_DNA-binding	0.37	22.3	Myb-like DNA-binding domain
6	PF15963 Myb_DNA-bind_7	1e+02	14.1	Myb DNA-binding like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338629

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.960	Histone deacetylase 1
2	9606.ENSP00000430432	0.818	Histone deacetylase 2
3	9606.ENSP00000377721	0.791	COUP transcription factor 2
4	9606.ENSP00000325819	0.776	COUP transcription factor 1
5	9606.ENSP00000351446	0.767	WD repeat-containing protein 5
6	9606.ENSP00000355510	0.738	WD repeat-containing protein 64
7	9606.ENSP00000310998	0.734	N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
8	9606.ENSP00000364678	0.728	Histone-lysine N-methyltransferase EHMT2
9	9606.ENSP00000303758	0.706	Leucine zipper protein 1
10	9606.ENSP00000332296	0.682	Retinoic acid receptor beta
11	9606.ENSP00000384716	0.662	Probable palmitoyltransferase ZDHHC8
12	9606.ENSP00000350310	0.654	Plasma membrane calcium-transporting ATPase 4
13	9606.ENSP00000401564	0.648	Ran-specific GTPase-activating protein
14	9606.ENSP00000417185	0.647	Von Willebrand factor A domain-containing protein 1
15	9606.ENSP00000357979	0.636	Nuclear receptor subfamily 2 group E member 1
16	9606.ENSP00000432586	0.635	Protocadherin Fat 3
17	9606.ENSP00000368540	0.629	Ubiquitin associated protein 2
18	9606.ENSP00000344087	0.625	Autism susceptibility gene 2 protein
19	9606.ENSP00000348959	0.615	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
20	9606.ENSP00000216106	0.614	HMG domain-containing protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0140110	0.956	transcription regulator activity
GO:0003712	0.909	transcription coregulator activity
GO:0003714	0.871	transcription corepressor activity
GO:0140297	0.305	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.958	multicellular organismal process
GO:0032502	0.954	developmental process
GO:0050789	0.948	regulation of biological process
GO:0048731	0.943	system development
GO:0009987	0.939	cellular process
GO:0050794	0.903	regulation of cellular process
GO:0080090	0.888	regulation of primary metabolic process
GO:0060255	0.877	regulation of macromolecule metabolic process
GO:0051171	0.874	regulation of nitrogen compound metabolic process
GO:0048513	0.861	animal organ development
GO:0048523	0.838	negative regulation of cellular process
GO:0009653	0.757	anatomical structure morphogenesis
GO:0031323	0.473	regulation of cellular metabolic process
GO:0009889	0.456	regulation of biosynthetic process
GO:0010468	0.436	regulation of gene expression
GO:0031326	0.432	regulation of cellular biosynthetic process
GO:0051252	0.432	regulation of RNA metabolic process
GO:0006355	0.420	regulation of DNA-templated transcription
GO:0071840	0.402	cellular component organization or biogenesis
GO:0016043	0.358	cellular component organization
GO:0009892	0.324	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0032991	0.980	protein-containing complex
GO:1902494	0.687	catalytic complex
GO:0005737	0.585	cytoplasm
GO:0140513	0.513	nuclear protein-containing complex
GO:0000118	0.311	histone deacetylase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]