StarFunc result for job id Q9P2S2

User Input

>input (1712 residues)
MASGSRWRPTPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRTN
ATRALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTRD
ARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKF
CSEEEHPMEGPAHLTLNSEVGSLLFSEGGAGRGGAGDVHQPTKGKEEFVATFKGNEFFCY
DLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTM
LGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQG
DLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGG
GAGSHSSAQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKG
SISVNSRSTPFLATGDSEILDLESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRD
LFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGVCREGWNRFICDCIGTG
FLGRVCEREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADT
LRLELDGGQMKLTVNLDCLRVGCAPSKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSVD
NVTVEGQMAGAHMRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGD
ITYCELNARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSG
NGNDFIVIELVKGYIHYVFDLGNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDS
RTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIA
DALHRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYI
FGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTV
GVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERL
AIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKV
LALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRG
RSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGGELILPIITEDSLDPPPVATRS
PFVPPPPTFYPFLTGVGATQDTLPPPAARRPPSGGPCQAERDDSDCEEPIEASGFASGEV
FDSSLPPTDDEDFYTTFPLVTDRTTLLSPRKPAPRPNLRTDGATGAPGVLFAPSAPAPNL
PAGKMNHRDPLQPLLENPPLGPGAPTSFEPRRPPPLRPGVTSAPGFPHLPTANPTGPGER
GPPGAVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYISNS
AQSNGAVVKEKAPAAPKTPSKAKKNKDKEYYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:I2HAJ6	0.331	0.330	0.000	1725	0.242	0.240	I2HAJ6.pdb.gz	I2HAJ6_CAEEL Neurexin-3-beta OS=Caenorhabditis elegans OX=6239 GN=nrx-1 PE=4 SV=1
2	AFDB:Q9P2S2	1.000	1.000	0.000	1712	1.000	1.000	Q9P2S2.pdb.gz	NRX2A_HUMAN Neurexin-2 OS=Homo sapiens OX=9606 GN=NRXN2 PE=2 SV=1
3	AFDB:Q52KB6	0.082	0.073	5.656E-10	2323	0.122	0.090	Q52KB6.pdb.gz	C2CD3_MOUSE C2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=C2cd3 PE=1 SV=3
4	AFDB:P97798	0.034	0.037	4.556E-9	1493	0.095	0.109	P97798.pdb.gz	NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 PE=1 SV=2
5	PDB:3v0aB	0.074	0.097	1.645E-5	1150	0.022	0.032	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
6	PDB:3ffzA	0.073	0.091	4.050E-5	1246	0.024	0.033	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
7	PDB:7zl1A	0.080	0.536	4.050E-5	215	0.015	0.121	7zl1A.pdb.gz
8	AFDB:Q9W213	0.043	0.047	6.279E-5	1395	0.116	0.143	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
9	PDB:7ua3A	0.065	0.035	9.070E-5	4443	0.098	0.038	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
10	PDB:2a3wA	0.077	0.500	9.510E-5	204	0.020	0.167	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
11	PDB:7tzcA	0.075	0.039	9.972E-5	4404	0.081	0.032	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
12	PDB:5n0cA	0.063	0.082	1.205E-4	1293	0.029	0.039	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
13	PDB:7u9tA	0.067	0.037	1.264E-4	4229	0.075	0.030	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
14	AFDB:F1R2D2	0.044	0.044	1.406E-4	1687	0.095	0.096	F1R2D2.pdb.gz
15	PDB:6m5yA	0.060	0.292	1.847E-4	270	0.025	0.156	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
16	PDB:1b09A	0.083	0.584	2.233E-4	206	0.014	0.117	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
17	AFDB:O55005	0.049	0.050	3.148E-4	1651	0.106	0.110	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
18	AFDB:A0A2R8QRK0	0.043	0.047	1.080E-3	1420	0.095	0.115	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
19	AFDB:E9QJ12	0.044	0.058	4.480E-3	1031	0.086	0.144	E9QJ12.pdb.gz
20	AFDB:Q9JIR0	0.039	0.037	6.081E-2	1847	0.059	0.055	Q9JIR0.pdb.gz	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KGL0	833	1847	0.303	0.280	A0A0B4KGL0_DROME Neurexin 1, isoform F OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=4 SV=1
2	A0A0B4KGQ3	825	1825	0.289	0.271	A0A0B4KGQ3_DROME Neurexin 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=4 SV=1
3	A0A0B4KH61	826	1525	0.290	0.325	A0A0B4KH61_DROME Neurexin 1, isoform G OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=4 SV=1
4	A0A0R4J2G7	1964	1495	0.559	0.640	A0A0R4J2G7_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
5	A0A1D5RMU6	1968	1499	0.560	0.639	A0A1D5RMU6_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
6	A1XQX0	1949	1491	0.554	0.636	NR1AA_DANRE Neurexin-1a OS=Danio rerio OX=7955 GN=nrxn1a PE=2 SV=1
7	A1XQX4	2368	1670	0.703	0.721	A1XQX4_DANRE Neurexin 2a alpha OS=Danio rerio OX=7955 GN=nrxn2a PE=2 SV=1
8	B7ZCV1	655	648	0.223	0.588	B7ZCV1_DANRE Neurexin 2a OS=Danio rerio OX=7955 GN=nrxn2a PE=4 SV=1
9	D0PRN4	620	668	0.206	0.528	NRX3B_CHICK Neurexin-3-beta OS=Gallus gallus OX=9031 GN=NRXN3 PE=1 SV=2
10	E7ERL8	1989	1507	0.564	0.640	E7ERL8_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
11	E9Q7X7	3449	1710	0.982	0.983	NRX2A_MOUSE Neurexin-2 OS=Mus musculus OX=10090 GN=Nrxn2 PE=1 SV=1
12	P58401	1172	666	0.337	0.866	NRX2B_HUMAN Neurexin-2-beta OS=Homo sapiens OX=9606 GN=NRXN2 PE=1 SV=1
13	Q28146	1999	1530	0.565	0.633	NRX1A_BOVIN Neurexin-1 OS=Bos taurus OX=9913 GN=NRXN1 PE=1 SV=1
14	Q3KN41	827	1840	0.289	0.269	NRX1_DROME Neurexin 1 OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=1 SV=1
15	Q63372	2007	1530	0.567	0.635	NRX1A_RAT Neurexin-1 OS=Rattus norvegicus OX=10116 GN=Nrxn1 PE=1 SV=3
16	Q6P9K9	1887	1571	0.541	0.590	NRX3A_MOUSE Neurexin-3 OS=Mus musculus OX=10090 GN=Nrxn3 PE=1 SV=2
17	Q9CS84	2006	1514	0.567	0.641	NRX1A_MOUSE Neurexin-1 OS=Mus musculus OX=10090 GN=Nrxn1 PE=1 SV=3
18	Q9HDB5	565	637	0.197	0.531	NRX3B_HUMAN Neurexin-3-beta OS=Homo sapiens OX=9606 GN=NRXN3 PE=1 SV=4
19	Q9P2S2	3514	1712	1.000	1.000	NRX2A_HUMAN Neurexin-2 OS=Homo sapiens OX=9606 GN=NRXN2 PE=2 SV=1
20	Q9ULB1	1913	1477	0.547	0.634	NRX1A_HUMAN Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02656 DUF202	2.9e+02	13.3	Domain of unknown function (DUF202)
2	PF00008 EGF	0.0043	28.6	EGF-like domain
3	PF00054 Laminin_G_1	1.5e-95	327.8	Laminin G domain
4	PF02210 Laminin_G_2	1.7e-160	537.7	Laminin G domain
5	PF13385 Laminin_G_3	4e-22	90.4	Concanavalin A-like lectin/glucanases superfamily
6	PF01034 Syndecan	0.063	24.5	Syndecan domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265459

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305288	0.998	Neuroligin-2
2	9606.ENSP00000392500	0.998	Neuroligin-1
3	9606.ENSP00000370485	0.990	Neuroligin-4, X-linked
4	9606.ENSP00000351591	0.989	Neuroligin-3
5	9606.ENSP00000274711	0.984	Leucine-rich repeat transmembrane neuronal protein 2
6	9606.ENSP00000384551	0.984	Neurexophilin-1
7	9606.ENSP00000282020	0.971	Glutamate receptor ionotropic, delta-2
8	9606.ENSP00000219197	0.969	Cerebellin-1
9	9606.ENSP00000382428	0.966	Disks large homolog 4
10	9606.ENSP00000367408	0.957	Peripheral plasma membrane protein CASK
11	9606.ENSP00000295057	0.954	Leucine-rich repeat transmembrane neuronal protein 1
12	9606.ENSP00000355187	0.925	Leucine-rich repeat transmembrane neuronal protein 3
13	9606.ENSP00000386357	0.906	Leucine-rich repeat transmembrane neuronal protein 4
14	9606.ENSP00000269503	0.904	Cerebellin-2
15	9606.ENSP00000453293	0.894	Amyloid-beta A4 precursor protein-binding family A member 2
16	9606.ENSP00000469689	0.884	SH3 and multiple ankyrin repeat domains protein 2
17	9606.ENSP00000265381	0.877	Amyloid-beta A4 precursor protein-binding family A member 1
18	9606.ENSP00000293441	0.877	SH3 and multiple ankyrin repeat domains protein 1
19	9606.ENSP00000261205	0.873	Synaptotagmin-1
20	9606.ENSP00000385142	0.852	Neurexin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.999	signaling receptor activity
GO:0005102	0.994	signaling receptor binding
GO:0050839	0.992	cell adhesion molecule binding
GO:0005246	0.990	calcium channel regulator activity
GO:0004888	0.642	transmembrane signaling receptor activity
GO:0043167	0.419	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0023052	0.984	signaling
GO:0007275	0.975	multicellular organism development
GO:0050794	0.968	regulation of cellular process
GO:0007267	0.966	cell-cell signaling
GO:0048731	0.966	system development
GO:0016043	0.958	cellular component organization
GO:0007399	0.945	nervous system development
GO:0099536	0.934	synaptic signaling
GO:0050896	0.921	response to stimulus
GO:0034330	0.885	cell junction organization
GO:0006836	0.870	neurotransmitter transport
GO:0065008	0.830	regulation of biological quality
GO:0022607	0.790	cellular component assembly
GO:0007155	0.785	cell adhesion
GO:0034329	0.723	cell junction assembly
GO:0033036	0.691	macromolecule localization
GO:0009605	0.675	response to external stimulus
GO:0099537	0.658	trans-synaptic signaling
GO:0007268	0.629	chemical synaptic transmission
GO:0007610	0.591	behavior
GO:0051641	0.589	cellular localization
GO:0140352	0.473	export from cell
GO:0050877	0.459	nervous system process
GO:0050808	0.432	synapse organization
GO:0051716	0.422	cellular response to stimulus
GO:0007416	0.418	synapse assembly
GO:0010646	0.414	regulation of cell communication
GO:0023051	0.411	regulation of signaling
GO:0050890	0.406	cognition
GO:0008104	0.384	protein localization
GO:0007638	0.357	mechanosensory behavior
GO:0048518	0.342	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0032991	0.964	protein-containing complex
GO:0030054	0.921	cell junction
GO:0045202	0.888	synapse
GO:0005622	0.730	intracellular anatomical structure
GO:0043226	0.597	organelle
GO:0043227	0.496	membrane-bounded organelle
GO:0043231	0.402	intracellular membrane-bounded organelle
GO:0005737	0.376	cytoplasm
GO:0098978	0.350	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]