StarFunc result for job id Q9P2S5

User Input

>input (460 residues)
MNFSEVFKLSSLLCKFSPDGKYLASCVQYRLVVRDVNTLQILQLYTCLDQIQHIEWSADS
LFILCAMYKRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWS
LCTKSVSYIKYPKACLQGITFTRDGRYMALAERRDCKDYVSIFVCSDWQLLRHFDTDTQD
LTGIEWAPNGCVLAVWDTCLEYKILLYSLDGRLLSTYSAYEWSLGIKSVAWSPSSQFLAV
GSYDGKVRILNHVTWKMITEFGHPAAINDPKIVVYKEAEKSPQLGLGCLSFPPPRAGAGP
LPSSESKYEIASVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRNDNIPNAVWVWD
IQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLS
LCWHLSGDSMALLSKDHFCLCFLETEAVVGTACRQLGGHT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P2S5	1.000	1.000	6.150E-86	460	1.000	1.000	Q9P2S5.pdb.gz	WRP73_HUMAN WD repeat-containing protein WRAP73 OS=Homo sapiens OX=9606 GN=WRAP73 PE=1 SV=1
2	AFDB:Q9JM98	0.960	0.956	1.513E-77	462	0.883	0.879	Q9JM98.pdb.gz	WRP73_MOUSE WD repeat-containing protein WRAP73 OS=Mus musculus OX=10090 GN=Wrap73 PE=1 SV=2
3	AFDB:Q96WW0	0.844	0.806	2.747E-30	483	0.213	0.203	Q96WW0.pdb.gz	YNH9_SCHPO Uncharacterized WD repeat-containing protein C32H8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi015 PE=4 SV=1
4	AFDB:O62471	0.315	0.101	9.086E-19	1592	0.135	0.039	O62471.pdb.gz	QUI1_CAEEL Protein qui-1 OS=Caenorhabditis elegans OX=6239 GN=qui-1 PE=1 SV=2
5	PDB:5wyjBA	0.344	0.230	1.935E-18	755	0.174	0.106	5wyjBA.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
6	AFDB:Q5A852	0.335	0.187	4.825E-18	922	0.157	0.078	Q5A852.pdb.gz	Q5A852_CANAL SnoRNA-binding rRNA-processing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PWP2 PE=3 SV=1
7	AFDB:Q9C1X1	0.337	0.201	7.775E-18	854	0.159	0.085	Q9C1X1.pdb.gz	PWP2_SCHPO Periodic tryptophan protein 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC713.04c PE=1 SV=1
8	AFDB:P25635	0.337	0.190	8.972E-18	923	0.170	0.085	P25635.pdb.gz	PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PWP2 PE=1 SV=2
9	AFDB:O88879	0.349	0.151	2.019E-17	1249	0.143	0.053	O88879.pdb.gz	APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus OX=10090 GN=Apaf1 PE=1 SV=3
10	PDB:7mq8LO	0.330	0.198	7.621E-17	848	0.141	0.077	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	AFDB:Q5U3Q5	0.454	0.264	8.052E-17	897	0.124	0.064	Q5U3Q5.pdb.gz	Q5U3Q5_DANRE Transducin beta-like protein 3 OS=Danio rerio OX=7955 GN=zgc:101778 PE=1 SV=1
12	AFDB:Q8T9D3	0.284	0.127	8.446E-17	1169	0.165	0.065	Q8T9D3.pdb.gz	Q8T9D3_DROME SD05642p OS=Drosophila melanogaster OX=7227 GN=Oseg1 PE=2 SV=1
13	PDB:6lqsB1	0.322	0.204	1.635E-16	806	0.180	0.103	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
14	PDB:7mqaLO	0.332	0.205	3.508E-16	819	0.139	0.078	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7ajtUA	0.357	0.221	4.047E-16	834	0.176	0.097	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7mqaLQ	0.292	0.187	5.928E-16	830	0.152	0.084	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7mq8LR	0.291	0.202	7.175E-16	773	0.148	0.088	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:5mzhB	0.524	0.572	8.279E-16	415	0.120	0.133	5mzhB.pdb.gz
19	PDB:5nnzA	0.537	0.704	1.156E-15	335	0.109	0.149	5nnzA.pdb.gz
20	PDB:3sfzA	0.358	0.174	3.996E-15	1133	0.157	0.064	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JM98	0.0	857	462	0.883	0.879	WRP73_MOUSE WD repeat-containing protein WRAP73 OS=Mus musculus OX=10090 GN=Wrap73 PE=1 SV=2
2	Q9P2S5	0.0	950	460	1.000	1.000	WRP73_HUMAN WD repeat-containing protein WRAP73 OS=Homo sapiens OX=9606 GN=WRAP73 PE=1 SV=1
3	Q96WW0	1.58e-19	93.2	483	0.222	0.211	YNH9_SCHPO Uncharacterized WD repeat-containing protein C32H8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi015 PE=4 SV=1
4	Q54KL5	2.53e-06	51.6	335	0.135	0.185	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
5	Q9VU65	6.68e-06	50.4	391	0.135	0.159	POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster OX=7227 GN=Poc1 PE=2 SV=1
6	Q9UUG8	1.44e-05	49.7	598	0.109	0.084	TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tup12 PE=1 SV=2
7	Q386A1	4.40e-05	48.5	641	0.043	0.031	Q386A1_TRYB2 Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1620 PE=4 SV=1
8	C8V0I4	5.14e-05	48.1	574	0.126	0.101	C8V0I4_EMENI Transcriptional corepressor (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06505 PE=4 SV=1
9	Q09715	6.07e-05	47.8	614	0.135	0.101	TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tup11 PE=1 SV=1
10	C8VF02	7.43e-05	47.8	836	0.080	0.044	C8VF02_EMENI SepB protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10635 PE=4 SV=1
11	O48847	8.04e-05	47.8	787	0.135	0.079	LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana OX=3702 GN=LUH PE=1 SV=1
12	Q9AV81	9.49e-05	47.0	527	0.087	0.076	PRP19_ORYSJ Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica OX=39947 GN=PRP19 PE=2 SV=1
13	Q8NBT0	1.52e-04	46.2	407	0.148	0.167	POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens OX=9606 GN=POC1A PE=1 SV=2
14	Q9FNN2	3.39e-04	45.4	589	0.137	0.107	WDR26_ARATH WD repeat-containing protein 26 homolog OS=Arabidopsis thaliana OX=3702 GN=WDR26 PE=1 SV=1
15	Q8TBZ3	3.67e-04	45.4	569	0.050	0.040	WDR20_HUMAN WD repeat-containing protein 20 OS=Homo sapiens OX=9606 GN=WDR20 PE=1 SV=2
16	Q229Z6	4.17e-04	45.1	634	0.120	0.087	POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_01308010 PE=3 SV=1
17	Q5T1M7	7.41e-04	44.3	521	0.143	0.127	Q5T1M7_HUMAN 60 kDa U4/U6 snRNP-specific spliceosomal protein OS=Homo sapiens OX=9606 GN=PRPF4 PE=2 SV=1
18	O43172	7.95e-04	44.3	522	0.143	0.126	PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens OX=9606 GN=PRPF4 PE=1 SV=2
19	Q9VU68	0.001	43.5	608	0.104	0.079	WDR1_DROME Actin-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=flr PE=2 SV=1
20	P78972	0.002	43.1	488	0.135	0.127	SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.5e-09	49.3	Anaphase-promoting complex subunit 4 WD40 domain
2	PF10742 DUF2555	2.2e+02	13.1	Protein of unknown function (DUF2555)
3	PF08662 eIF2A	1e-05	37.1	Eukaryotic translation initiation factor eIF2A
4	PF04762 IKI3	50	13.3	IKI3 family
5	PF07676 PD40	31	15.9	WD40-like Beta Propeller Repeat
6	PF00400 WD40	1.8e-09	49.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000270708

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340279	0.949	Afadin- and alpha-actinin-binding protein
2	9606.ENSP00000257287	0.873	Centrosomal protein of 135 kDa
3	9606.ENSP00000367595	0.837	Tumor protein p63 regulated 1 like
4	9606.ENSP00000384527	0.814	Zinc finger and BTB domain-containing protein 40
5	9606.ENSP00000348982	0.813	Multiple epidermal growth factor-like domains protein 6
6	9606.ENSP00000367629	0.763	Rho guanine nucleotide exchange factor 16
7	9606.ENSP00000380495	0.743	ATP-dependent RNA helicase DDX51
8	9606.ENSP00000306614	0.698	Peptidyl-prolyl cis-trans isomerase H
9	9606.ENSP00000475168	0.692	Protein RER1
10	9606.ENSP00000367086	0.685	Cytosolic acyl coenzyme A thioester hydrolase
11	9606.ENSP00000393963	0.657	Kinesin-like protein KIFC1
12	9606.ENSP00000451211	0.648	Protein NEDD1
13	9606.ENSP00000317872	0.642	E3 ubiquitin-protein ligase RBBP6
14	9606.ENSP00000282003	0.618	E3 ubiquitin ligase essential for DNA replication origin activation during S phase . Acts as a replication origin selector which selects the origins to be fired and catalyzes the multi-mono-ubiquitination of a subset of chromatin-bound ORC3 and ORC5 during S-phase
15	9606.ENSP00000386414	0.612	Double-strand-break repair protein rad21-like protein 1
16	9606.ENSP00000300692	0.609	T-cell surface glycoprotein CD3 delta chain
17	9606.ENSP00000367545	0.591	Tumor protein p73
18	9606.ENSP00000361626	0.579	Nuclease-sensitive element-binding protein 1
19	9606.ENSP00000346442	0.574	Lymphoid-restricted membrane protein
20	9606.ENSP00000386456	0.566	AP2-associated protein kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0000226	0.982	microtubule cytoskeleton organization
GO:0048522	0.981	positive regulation of cellular process
GO:0070925	0.957	organelle assembly
GO:0090307	0.948	mitotic spindle assembly
GO:1902115	0.943	regulation of organelle assembly
GO:0120032	0.931	regulation of plasma membrane bounded cell projection assembly
GO:0010638	0.888	positive regulation of organelle organization
GO:0044089	0.879	positive regulation of cellular component biogenesis
GO:1902117	0.855	positive regulation of organelle assembly
GO:0120034	0.835	positive regulation of plasma membrane bounded cell projection assembly
GO:1902017	0.816	regulation of cilium assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005856	1.000	cytoskeleton
GO:0005815	0.987	microtubule organizing center
GO:0005813	0.984	centrosome
GO:0005929	0.796	cilium
GO:0043231	0.733	intracellular membrane-bounded organelle
GO:0036064	0.711	ciliary basal body
GO:0005737	0.631	cytoplasm
GO:0032991	0.626	protein-containing complex
GO:0005829	0.320	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]