StarFunc result for job id Q9P2T1

User Input

>input (348 residues)
MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGT
FEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAI
PQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGI
GPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVM
LGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGD
VEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99L27	0.999	0.999	9.412E-73	348	0.951	0.951	Q99L27.pdb.gz	GMPR2_MOUSE GMP reductase 2 OS=Mus musculus OX=10090 GN=Gmpr2 PE=1 SV=2
2	AFDB:P36959	0.989	0.997	1.905E-66	345	0.790	0.797	P36959.pdb.gz	GMPR1_HUMAN GMP reductase 1 OS=Homo sapiens OX=9606 GN=GMPR PE=1 SV=1
3	PDB:2a7rA	0.948	0.976	7.201E-64	338	0.971	1.000	2a7rA.pdb.gz	Crystal Structure of Human Guanosine Monophosphate Reductase 2 (GMPR2) in Complex with GMP
4	AFDB:P60560	0.986	0.989	1.829E-60	347	0.681	0.683	P60560.pdb.gz	GUAC_ECOLI GMP reductase OS=Escherichia coli (strain K12) OX=83333 GN=guaC PE=1 SV=1
5	PDB:2a7rD	0.900	0.988	3.323E-60	317	0.905	0.994	2a7rD.pdb.gz	Crystal Structure of Human Guanosine Monophosphate Reductase 2 (GMPR2) in Complex with GMP
6	PDB:2bleA	0.941	0.972	9.755E-58	337	0.770	0.795	2bleA.pdb.gz	Structure of Human Guanosine Monophosphate Reductase Gmpr1 in Complex with Gmp
7	AFDB:Q57ZS7	0.829	0.593	1.611E-33	491	0.345	0.244	Q57ZS7.pdb.gz	Q57ZS7_TRYB2 Inosine-5'-monophosphate dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.1P6.110 PE=1 SV=1
8	AFDB:Q72D85	0.858	0.623	1.600E-32	485	0.342	0.245	Q72D85.pdb.gz	Q72D85_DESVH Inosine-5'-monophosphate dehydrogenase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=guaB PE=1 SV=1
9	PDB:6jigA	0.832	0.609	4.602E-32	480	0.345	0.250	6jigA.pdb.gz	Allosteric regulation accompanied by oligomeric state changes of Trypanosoma brucei GMP reductase through cystathionine-beta-synthase domain.
10	AFDB:P0ADG7	0.851	0.613	1.417E-31	488	0.333	0.238	P0ADG7.pdb.gz	IMDH_ECOLI Inosine-5'-monophosphate dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=guaB PE=1 SV=1
11	PDB:7rerA	0.850	0.764	4.841E-31	389	0.287	0.257	7rerA.pdb.gz	IMPDH1 retinal variants control filament architecture to tune allosteric regulation.
12	AFDB:Q9HXM5	0.851	0.612	1.056E-30	489	0.333	0.237	Q9HXM5.pdb.gz	Q9HXM5_PSEAE Inosine-5'-monophosphate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=guaB PE=1 SV=1
13	PDB:7rglA	0.826	0.695	5.712E-30	416	0.290	0.243	7rglA.pdb.gz	IMPDH1 retinal variants control filament architecture to tune allosteric regulation.
14	AFDB:P9WKI3	0.835	0.613	5.910E-30	479	0.368	0.267	P9WKI3.pdb.gz	GUAB1_MYCTU GMP reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=guaB1 PE=1 SV=1
15	AFDB:P9WKI7	0.832	0.555	7.435E-30	529	0.319	0.210	P9WKI7.pdb.gz	IMDH_MYCTU Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=guaB PE=1 SV=1
16	PDB:6jl8A	0.735	0.570	4.775E-29	453	0.333	0.256	6jl8A.pdb.gz
17	AFDB:A0A384N6C2	0.820	0.561	1.238E-28	514	0.279	0.189	A0A384N6C2.pdb.gz	A0A384N6C2_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH PE=2 SV=1
18	PDB:6gk9G	0.783	0.826	2.672E-28	329	0.313	0.331	6gk9G.pdb.gz	First-in-class allosteric inhibitors of bacterial IMPDHs.
19	PDB:1nf7A	0.809	0.625	5.023E-28	454	0.279	0.214	1nf7A.pdb.gz	Crystal Structure of Human Inosine Monophosphate Dehydrogenase type II complexed with the MPA/NAD analog C2-MAD
20	PDB:1me7A	0.846	0.808	1.495E-27	365	0.261	0.249	1me7A.pdb.gz	Crystal Structure of Tritrichomonas foetus Inosine Monophosphate Dehydrogenase in Complex with the Inhibitor Ribavirin Monophosphate Reveals a Catalysis-dependent Ion-binding Site

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P36959	0.0	590	345	0.790	0.797	GMPR1_HUMAN GMP reductase 1 OS=Homo sapiens OX=9606 GN=GMPR PE=1 SV=1
2	P60560	0.0	506	347	0.681	0.683	GUAC_ECOLI GMP reductase OS=Escherichia coli (strain K12) OX=83333 GN=guaC PE=1 SV=1
3	Q99L27	0.0	692	348	0.951	0.951	GMPR2_MOUSE GMP reductase 2 OS=Mus musculus OX=10090 GN=Gmpr2 PE=1 SV=2
4	Q9P2T1	0.0	721	348	1.000	1.000	GMPR2_HUMAN GMP reductase 2 OS=Homo sapiens OX=9606 GN=GMPR2 PE=1 SV=1
5	Q9Z244	0.0	590	345	0.790	0.797	GMPR1_RAT GMP reductase 1 OS=Rattus norvegicus OX=10116 GN=Gmpr PE=2 SV=1
6	Q72D85	4.87e-47	167	485	0.273	0.196	Q72D85_DESVH Inosine-5'-monophosphate dehydrogenase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=guaB PE=1 SV=1
7	P9WKI3	9.74e-45	161	479	0.270	0.196	GUAB1_MYCTU GMP reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=guaB1 PE=1 SV=1
8	Q57ZS7	5.07e-44	160	491	0.276	0.196	Q57ZS7_TRYB2 Inosine-5'-monophosphate dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.1P6.110 PE=1 SV=1
9	Q9HXM5	3.97e-36	138	489	0.244	0.174	Q9HXM5_PSEAE Inosine-5'-monophosphate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=guaB PE=1 SV=1
10	P9WKI7	4.19e-34	133	529	0.259	0.170	IMDH_MYCTU Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=guaB PE=1 SV=1
11	P0ADG7	5.87e-34	132	488	0.241	0.172	IMDH_ECOLI Inosine-5'-monophosphate dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=guaB PE=1 SV=1
12	B0UXP9	1.31e-32	129	514	0.230	0.156	IMDH2_DANRE Inosine-5'-monophosphate dehydrogenase 2 OS=Danio rerio OX=7955 GN=impdh2 PE=3 SV=1
13	Q6FM59	1.13e-31	126	527	0.236	0.156	Q6FM59_CANGA Inosine-5'-monophosphate dehydrogenase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K10780g PE=3 SV=1
14	P24547	3.25e-31	125	514	0.250	0.169	IMDH2_MOUSE Inosine-5'-monophosphate dehydrogenase 2 OS=Mus musculus OX=10090 GN=Impdh2 PE=1 SV=2
15	E9PU28	8.31e-31	124	514	0.213	0.144	IMDH2_RAT Inosine-5'-monophosphate dehydrogenase 2 OS=Rattus norvegicus OX=10116 GN=Impdh2 PE=1 SV=1
16	Q9SA34	1.14e-30	123	502	0.250	0.173	IMDH2_ARATH Inosine-5'-monophosphate dehydrogenase 2 OS=Arabidopsis thaliana OX=3702 GN=At1g16350 PE=1 SV=1
17	Q59Q46	1.96e-30	123	521	0.218	0.146	IMDH_CANAL Inosine-5'-monophosphate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IMH3 PE=1 SV=2
18	P50094	3.41e-30	122	524	0.230	0.153	IMDH4_YEAST Inosine-5'-monophosphate dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMD4 PE=1 SV=1
19	E7ETK5	3.76e-30	122	489	0.213	0.151	E7ETK5_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2
20	A0A384N6C2	6.26e-30	121	514	0.213	0.144	A0A384N6C2_HUMAN Inosine-5'-monophosphate dehydrogenase OS=Homo sapiens OX=9606 GN=IMPDH PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01081 Aldolase	1.5e+02	13.2	KDPG and KHG aldolase
2	PF01070 FMN_dh	0.046	24.4	FMN-dependent dehydrogenase
3	PF01645 Glu_synthase	1.5e+02	12.9	Conserved region in glutamate synthase
4	PF00478 IMPDH	1.5e-77	272.5	IMP dehydrogenase / GMP reductase domain
5	PF01729 QRPTase_C	1.7e+02	13.4	Quinolinate phosphoribosyl transferase, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000010538

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000026780	0.994	Guanine monphosphate synthetase
2	9598.ENSPTRP00000041425	0.976	5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
3	9598.ENSPTRP00000003684	0.972	Adenylosuccinate synthetase isozyme 2
4	9598.ENSPTRP00000001828	0.963	AMP deaminase
5	9598.ENSPTRP00000011563	0.963	Adenylosuccinate synthetase
6	9598.ENSPTRP00000001955	0.961	AMP deaminase
7	9598.ENSPTRP00000005861	0.961	AMP deaminase
8	9598.ENSPTRP00000038394	0.954	Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5- phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway (By similarity)
9	9598.ENSPTRP00000014433	0.935	Adenine phosphoribosyltransferase
10	9598.ENSPTRP00000022599	0.931	Inosine triphosphate pyrophosphatase
11	9598.ENSPTRP00000041919	0.925	Inosine-5'-monophosphate dehydrogenase
12	9598.ENSPTRP00000030306	0.923	GMP reductase
13	9598.ENSPTRP00000051068	0.920	Uncharacterized protein
14	9598.ENSPTRP00000025479	0.904	Uncharacterized protein
15	9598.ENSPTRP00000034382	0.904	Ectonucleoside triphosphate diphosphohydrolase 4
16	9598.ENSPTRP00000041745	0.904	Uncharacterized protein
17	9598.ENSPTRP00000048610	0.904	Uncharacterized protein
18	9598.ENSPTRP00000049619	0.904	Uncharacterized protein
19	9598.ENSPTRP00000050446	0.904	Ectonucleoside triphosphate diphosphohydrolase 1
20	9598.ENSPTRP00000011079	0.902	Ectonucleoside triphosphate diphosphohydrolase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016661	0.999	oxidoreductase activity, acting on other nitrogenous compounds as donors
GO:0005515	0.997	protein binding
GO:0046857	0.876	oxidoreductase activity, acting on other nitrogenous compounds as donors, with NAD or NADP as acceptor
GO:0003920	0.792	GMP reductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006753	0.988	nucleoside phosphate metabolic process
GO:1901564	0.984	organonitrogen compound metabolic process
GO:1901135	0.983	carbohydrate derivative metabolic process
GO:0009117	0.982	nucleotide metabolic process
GO:0006163	0.973	purine nucleotide metabolic process
GO:0009123	0.967	nucleoside monophosphate metabolic process
GO:0009259	0.965	ribonucleotide metabolic process
GO:0009161	0.955	ribonucleoside monophosphate metabolic process
GO:0009126	0.948	purine nucleoside monophosphate metabolic process
GO:0009150	0.947	purine ribonucleotide metabolic process
GO:0009167	0.943	purine ribonucleoside monophosphate metabolic process
GO:1901576	0.848	organic substance biosynthetic process
GO:0044249	0.848	cellular biosynthetic process
GO:0034654	0.843	nucleobase-containing compound biosynthetic process
GO:0050896	0.773	response to stimulus
GO:1901293	0.708	nucleoside phosphate biosynthetic process
GO:0009156	0.649	ribonucleoside monophosphate biosynthetic process
GO:0009127	0.649	purine nucleoside monophosphate biosynthetic process
GO:0009165	0.640	nucleotide biosynthetic process
GO:0072522	0.608	purine-containing compound biosynthetic process
GO:0046390	0.557	ribose phosphate biosynthetic process
GO:0009260	0.531	ribonucleotide biosynthetic process
GO:0009168	0.515	purine ribonucleoside monophosphate biosynthetic process
GO:0009152	0.485	purine ribonucleotide biosynthetic process
GO:0046040	0.475	IMP metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.7.-.-	0.999	Acting on other nitrogenous compounds as donors.
EC:1.7.1.-	0.876	With NAD(+) or NADP(+) as acceptor.
RHEA:17185	0.792	IMP + NADP(+) + NH4(+) = GMP + 2 H(+) + NADPH
EC:1.7.1.7	0.792	GMP reductase.

[back to server]