StarFunc result for job id Q9P2U7

User Input

>input (560 residues)
MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLP
RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIH
GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFT
SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
IADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
GGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPS
YGATHSTFQPPRPPPPVRDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3TXX4	0.939	0.939	7.733E-73	560	0.986	0.986	Q3TXX4.pdb.gz	VGLU1_MOUSE Vesicular glutamate transporter 1 OS=Mus musculus OX=10090 GN=Slc17a7 PE=1 SV=2
2	AFDB:Q5W8I8	0.834	0.800	8.748E-59	584	0.768	0.736	Q5W8I8.pdb.gz	VGL2A_DANRE Vesicular glutamate transporter 2.1 OS=Danio rerio OX=7955 GN=slc17a6b PE=2 SV=2
3	AFDB:Q1L8X9	0.842	0.800	1.574E-58	590	0.711	0.675	Q1L8X9.pdb.gz	VGLU3_DANRE Vesicular glutamate transporter 3 OS=Danio rerio OX=7955 GN=slc17a8 PE=3 SV=2
4	AFDB:Q8BFU8	0.798	0.744	1.354E-55	601	0.729	0.679	Q8BFU8.pdb.gz	VGLU3_MOUSE Vesicular glutamate transporter 3 OS=Mus musculus OX=10090 GN=Slc17a8 PE=1 SV=1
5	AFDB:Q8BLE7	0.678	0.656	5.219E-54	582	0.762	0.734	Q8BLE7.pdb.gz	VGLU2_MOUSE Vesicular glutamate transporter 2 OS=Mus musculus OX=10090 GN=Slc17a6 PE=1 SV=1
6	AFDB:P34644	0.796	0.775	1.295E-41	576	0.466	0.453	P34644.pdb.gz	EAT4_CAEEL Probable vesicular glutamate transporter eat-4 OS=Caenorhabditis elegans OX=6239 GN=eat-4 PE=2 SV=2
7	AFDB:Q86P76	0.765	0.679	1.676E-40	632	0.463	0.410	Q86P76.pdb.gz	Q86P76_DROME RH74545p OS=Drosophila melanogaster OX=7227 GN=VGlut PE=2 SV=1
8	AFDB:Q5Q0U0	0.748	0.844	1.373E-31	495	0.325	0.368	Q5Q0U0.pdb.gz	S17A5_RAT Sialin OS=Rattus norvegicus OX=10116 GN=Slc17a5 PE=1 SV=1
9	AFDB:B2RE38	0.751	0.847	2.003E-31	495	0.336	0.380	B2RE38.pdb.gz	B2RE38_HUMAN cDNA, FLJ96906, highly similar to Homo sapiens solute carrier family 17 (anion/sugar transporter), member 5 (SLC17A5), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
10	AFDB:Q23514	0.671	0.773	6.524E-30	479	0.280	0.328	Q23514.pdb.gz	Q23514_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slc-17.1 PE=4 SV=3
11	PDB:7aaqA	0.565	0.639	1.201E-9	487	0.145	0.166	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
12	PDB:7sptA	0.579	0.678	1.362E-9	470	0.130	0.155	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
13	PDB:6thaA	0.518	0.630	2.781E-9	448	0.134	0.167	6thaA.pdb.gz
14	PDB:7bc7A	0.490	0.616	3.024E-9	432	0.107	0.139	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
15	PDB:3o7qA	0.521	0.679	3.289E-9	414	0.118	0.159	3o7qA.pdb.gz
16	PDB:7zh0A	0.549	0.613	3.577E-9	495	0.095	0.107	7zh0A.pdb.gz
17	PDB:4gbyA	0.597	0.692	9.794E-9	475	0.129	0.152	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
18	PDB:7wsmA	0.549	0.646	1.260E-8	464	0.134	0.162	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
19	PDB:4ybqB	0.573	0.681	7.987E-8	462	0.132	0.160	4ybqB.pdb.gz
20	PDB:6wbvA	0.564	0.715	7.987E-8	429	0.105	0.138	6wbvA.pdb.gz	Structure of hepcidin-bound ferroportin reveals iron homeostatic mechanisms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q1L8X9	0.0	850	590	0.723	0.686	VGLU3_DANRE Vesicular glutamate transporter 3 OS=Danio rerio OX=7955 GN=slc17a8 PE=3 SV=2
2	Q3TXX4	0.0	1136	560	0.986	0.986	VGLU1_MOUSE Vesicular glutamate transporter 1 OS=Mus musculus OX=10090 GN=Slc17a7 PE=1 SV=2
3	Q5W8I8	0.0	909	584	0.780	0.748	VGL2A_DANRE Vesicular glutamate transporter 2.1 OS=Danio rerio OX=7955 GN=slc17a6b PE=2 SV=2
4	Q62634	0.0	1134	560	0.984	0.984	VGLU1_RAT Vesicular glutamate transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc17a7 PE=1 SV=1
5	Q7TSF2	0.0	858	588	0.743	0.707	VGLU3_RAT Vesicular glutamate transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc17a8 PE=1 SV=2
6	Q8BFU8	0.0	837	601	0.732	0.682	VGLU3_MOUSE Vesicular glutamate transporter 3 OS=Mus musculus OX=10090 GN=Slc17a8 PE=1 SV=1
7	Q8BLE7	0.0	904	582	0.764	0.735	VGLU2_MOUSE Vesicular glutamate transporter 2 OS=Mus musculus OX=10090 GN=Slc17a6 PE=1 SV=1
8	Q8NDX2	0.0	852	589	0.738	0.701	VGLU3_HUMAN Vesicular glutamate transporter 3 OS=Homo sapiens OX=9606 GN=SLC17A8 PE=1 SV=1
9	Q9JI12	0.0	906	582	0.766	0.737	VGLU2_RAT Vesicular glutamate transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc17a6 PE=1 SV=1
10	Q9P2U7	0.0	1150	560	1.000	1.000	VGLU1_HUMAN Vesicular glutamate transporter 1 OS=Homo sapiens OX=9606 GN=SLC17A7 PE=2 SV=1
11	Q9P2U8	0.0	907	582	0.768	0.739	VGLU2_HUMAN Vesicular glutamate transporter 2 OS=Homo sapiens OX=9606 GN=SLC17A6 PE=2 SV=1
12	Q9VQC0	1.47e-167	491	632	0.448	0.397	Q9VQC0_DROME Vesicular glutamate transporter, isoform A OS=Drosophila melanogaster OX=7227 GN=VGlut PE=4 SV=2
13	Q86P76	1.83e-166	489	632	0.446	0.396	Q86P76_DROME RH74545p OS=Drosophila melanogaster OX=7227 GN=VGlut PE=2 SV=1
14	P34644	1.33e-165	484	576	0.439	0.427	EAT4_CAEEL Probable vesicular glutamate transporter eat-4 OS=Caenorhabditis elegans OX=6239 GN=eat-4 PE=2 SV=2
15	Q9NRA2	1.84e-115	353	495	0.336	0.380	S17A5_HUMAN Sialin OS=Homo sapiens OX=9606 GN=SLC17A5 PE=1 SV=2
16	B2RE38	5.90e-115	352	495	0.341	0.386	B2RE38_HUMAN cDNA, FLJ96906, highly similar to Homo sapiens solute carrier family 17 (anion/sugar transporter), member 5 (SLC17A5), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
17	Q8BN82	4.11e-111	342	495	0.325	0.368	S17A5_MOUSE Sialin OS=Mus musculus OX=10090 GN=Slc17a5 PE=1 SV=2
18	Q5Q0U0	5.04e-111	342	495	0.321	0.364	S17A5_RAT Sialin OS=Rattus norvegicus OX=10116 GN=Slc17a5 PE=1 SV=1
19	Q2PJ91	1.67e-101	317	474	0.296	0.350	Q2PJ91_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slc-17.1 PE=4 SV=1
20	Q23514	4.43e-101	315	479	0.296	0.347	Q23514_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slc-17.1 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	8.2e-44	161.6	Major Facilitator Superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010367763.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010353654.1	0.943	Solute carrier family 32 member 1
2	61622.XP_010381145.1	0.908	Solute carrier family 18 member A3
3	61622.XP_010367561.1	0.907	Solute carrier family 17 member 6
4	61622.XP_010387184.1	0.886	Solute carrier family 18 member A2
5	61622.XP_010374662.1	0.867	Solute carrier family 18 member A1
6	61622.XP_010381873.1	0.806	Solute carrier family 17 member 8
7	61622.XP_010378724.1	0.777	Synaptotagmin-1 isoform X1
8	61622.XP_010360722.1	0.770	Vesicle associated membrane protein 2
9	61622.XP_010375641.1	0.742	Discs large MAGUK scaffold protein 4
10	61622.XP_010351713.1	0.739	Glutamate decarboxylase 2-like
11	61622.XP_010383561.1	0.739	Glutamate decarboxylase 2
12	61622.XP_010353572.1	0.737	Belongs to the SNAP-25 family.
13	61622.XP_010360911.1	0.710	Synaptophysin
14	61622.XP_010384935.1	0.710	RAB3A, member RAS oncogene family
15	61622.XP_010375915.1	0.700	Glutamate decarboxylase 1 isoform X1
16	61622.XP_010377137.1	0.693	Synaptotagmin 2
17	61622.XP_010387479.1	0.691	Belongs to the parvalbumin family.
18	61622.XP_010359740.1	0.676	Protein unc-13 homolog A
19	61622.XP_010365075.1	0.672	Catalyzes two steps in the biosynthesis of the molybdenum cofactor. In the first step, molybdopterin is adenylated. Subsequently, molybdate is inserted into adenylated molybdopterin and AMP is released
20	61622.XP_010368878.1	0.652	Protein bassoon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005313	0.999	L-glutamate transmembrane transporter activity
GO:0005436	0.999	sodium:phosphate symporter activity
GO:0005488	0.917	binding
GO:0005515	0.852	protein binding
GO:0005315	0.800	inorganic phosphate transmembrane transporter activity
GO:0140788	0.648	L-glutamate uniporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0015698	0.989	inorganic anion transport
GO:0009987	0.984	cellular process
GO:0006836	0.978	neurotransmitter transport
GO:0006811	0.976	monoatomic ion transport
GO:0006817	0.966	phosphate ion transport
GO:0065007	0.944	biological regulation
GO:0015849	0.889	organic acid transport
GO:0055085	0.888	transmembrane transport
GO:0050789	0.883	regulation of biological process
GO:0050794	0.851	regulation of cellular process
GO:0032501	0.847	multicellular organismal process
GO:0015711	0.831	organic anion transport
GO:0071705	0.773	nitrogen compound transport
GO:0046942	0.767	carboxylic acid transport
GO:0015800	0.751	acidic amino acid transport
GO:0099504	0.724	synaptic vesicle cycle
GO:0006835	0.707	dicarboxylic acid transport
GO:0015807	0.694	L-amino acid transport
GO:0051938	0.662	L-glutamate import
GO:0055062	0.634	phosphate ion homeostasis
GO:1905039	0.625	carboxylic acid transmembrane transport
GO:1902475	0.612	L-alpha-amino acid transmembrane transport
GO:0015813	0.574	L-glutamate transmembrane transport
GO:0050896	0.487	response to stimulus
GO:0007154	0.420	cell communication
GO:0023052	0.406	signaling
GO:0032502	0.363	developmental process
GO:0007275	0.340	multicellular organism development
GO:0007268	0.335	chemical synaptic transmission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0045202	0.999	synapse
GO:0031090	0.999	organelle membrane
GO:0031410	0.999	cytoplasmic vesicle
GO:0008021	0.991	synaptic vesicle
GO:0030658	0.986	transport vesicle membrane
GO:0030672	0.983	synaptic vesicle membrane
GO:0005886	0.950	plasma membrane
GO:0043005	0.309	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.999	Na(+)(in) = Na(+)(out)
RHEA:66336	0.999	L-glutamate(out) = L-glutamate(in)

[back to server]