StarFunc result for job id Q9P2U8

User Input

>input (582 residues)
MESVKQRILAPGKEGLKNFAGKSLGQIYRVLEKKQDTGETIELTEDGKPLEVPERKAPLC
DCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWD
PETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCV
IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT
GWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFK
TPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMT
IIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVF
LIAALVHYGGVIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGT
TKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5W8I8	0.831	0.828	3.308E-61	584	0.849	0.846	Q5W8I8.pdb.gz	VGL2A_DANRE Vesicular glutamate transporter 2.1 OS=Danio rerio OX=7955 GN=slc17a6b PE=2 SV=2
2	AFDB:Q8BLE7	0.640	0.640	5.498E-61	582	0.973	0.973	Q8BLE7.pdb.gz	VGLU2_MOUSE Vesicular glutamate transporter 2 OS=Mus musculus OX=10090 GN=Slc17a6 PE=1 SV=1
3	AFDB:Q1L8X9	0.818	0.807	3.466E-58	590	0.735	0.725	Q1L8X9.pdb.gz	VGLU3_DANRE Vesicular glutamate transporter 3 OS=Danio rerio OX=7955 GN=slc17a8 PE=3 SV=2
4	AFDB:Q3TXX4	0.822	0.853	1.658E-56	560	0.735	0.764	Q3TXX4.pdb.gz	VGLU1_MOUSE Vesicular glutamate transporter 1 OS=Mus musculus OX=10090 GN=Slc17a7 PE=1 SV=2
5	AFDB:Q8BFU8	0.794	0.769	1.869E-55	601	0.722	0.699	Q8BFU8.pdb.gz	VGLU3_MOUSE Vesicular glutamate transporter 3 OS=Mus musculus OX=10090 GN=Slc17a8 PE=1 SV=1
6	AFDB:P34644	0.759	0.766	2.188E-39	576	0.436	0.441	P34644.pdb.gz	EAT4_CAEEL Probable vesicular glutamate transporter eat-4 OS=Caenorhabditis elegans OX=6239 GN=eat-4 PE=2 SV=2
7	AFDB:Q86P76	0.728	0.671	2.033E-37	632	0.436	0.402	Q86P76.pdb.gz	Q86P76_DROME RH74545p OS=Drosophila melanogaster OX=7227 GN=VGlut PE=2 SV=1
8	AFDB:B2RE38	0.699	0.819	1.641E-29	495	0.333	0.392	B2RE38.pdb.gz	B2RE38_HUMAN cDNA, FLJ96906, highly similar to Homo sapiens solute carrier family 17 (anion/sugar transporter), member 5 (SLC17A5), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
9	AFDB:Q5Q0U0	0.701	0.823	1.774E-29	495	0.332	0.390	Q5Q0U0.pdb.gz	S17A5_RAT Sialin OS=Rattus norvegicus OX=10116 GN=Slc17a5 PE=1 SV=1
10	AFDB:Q23514	0.635	0.755	3.896E-27	479	0.280	0.340	Q23514.pdb.gz	Q23514_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slc-17.1 PE=4 SV=3
11	PDB:4gbyA	0.575	0.688	1.104E-8	475	0.124	0.152	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
12	PDB:7bc7A	0.500	0.649	2.607E-8	432	0.093	0.125	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
13	PDB:7sptA	0.554	0.671	3.853E-8	470	0.127	0.157	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
14	PDB:7aaqA	0.540	0.631	4.332E-8	487	0.120	0.144	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
15	PDB:7zh0A	0.523	0.603	4.332E-8	495	0.122	0.143	7zh0A.pdb.gz
16	PDB:3o7qA	0.519	0.702	4.684E-8	414	0.108	0.152	3o7qA.pdb.gz
17	PDB:6thaA	0.489	0.613	5.065E-8	448	0.132	0.172	6thaA.pdb.gz
18	PDB:1pw4A	0.495	0.631	1.912E-7	434	0.122	0.164	1pw4A.pdb.gz
19	PDB:6s4mA	0.519	0.688	3.304E-7	426	0.095	0.129	6s4mA.pdb.gz
20	PDB:7wsmA	0.497	0.600	3.863E-7	464	0.127	0.159	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q1L8X9	0.0	897	590	0.741	0.731	VGLU3_DANRE Vesicular glutamate transporter 3 OS=Danio rerio OX=7955 GN=slc17a8 PE=3 SV=2
2	Q3TXX4	0.0	910	560	0.727	0.755	VGLU1_MOUSE Vesicular glutamate transporter 1 OS=Mus musculus OX=10090 GN=Slc17a7 PE=1 SV=2
3	Q5W8I8	0.0	1018	584	0.851	0.848	VGL2A_DANRE Vesicular glutamate transporter 2.1 OS=Danio rerio OX=7955 GN=slc17a6b PE=2 SV=2
4	Q62634	0.0	912	560	0.737	0.766	VGLU1_RAT Vesicular glutamate transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc17a7 PE=1 SV=1
5	Q7TSF2	0.0	901	588	0.737	0.730	VGLU3_RAT Vesicular glutamate transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc17a8 PE=1 SV=2
6	Q8BFU8	0.0	879	601	0.729	0.705	VGLU3_MOUSE Vesicular glutamate transporter 3 OS=Mus musculus OX=10090 GN=Slc17a8 PE=1 SV=1
7	Q8BLE7	0.0	1171	582	0.973	0.973	VGLU2_MOUSE Vesicular glutamate transporter 2 OS=Mus musculus OX=10090 GN=Slc17a6 PE=1 SV=1
8	Q8NDX2	0.0	886	589	0.718	0.710	VGLU3_HUMAN Vesicular glutamate transporter 3 OS=Homo sapiens OX=9606 GN=SLC17A8 PE=1 SV=1
9	Q9JI12	0.0	1176	582	0.976	0.976	VGLU2_RAT Vesicular glutamate transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc17a6 PE=1 SV=1
10	Q9P2U7	0.0	910	560	0.739	0.768	VGLU1_HUMAN Vesicular glutamate transporter 1 OS=Homo sapiens OX=9606 GN=SLC17A7 PE=2 SV=1
11	Q9P2U8	0.0	1200	582	1.000	1.000	VGLU2_HUMAN Vesicular glutamate transporter 2 OS=Homo sapiens OX=9606 GN=SLC17A6 PE=2 SV=1
12	Q9VQC0	4.04e-168	494	632	0.421	0.388	Q9VQC0_DROME Vesicular glutamate transporter, isoform A OS=Drosophila melanogaster OX=7227 GN=VGlut PE=4 SV=2
13	Q86P76	9.18e-167	490	632	0.419	0.386	Q86P76_DROME RH74545p OS=Drosophila melanogaster OX=7227 GN=VGlut PE=2 SV=1
14	P34644	2.59e-160	472	576	0.402	0.406	EAT4_CAEEL Probable vesicular glutamate transporter eat-4 OS=Caenorhabditis elegans OX=6239 GN=eat-4 PE=2 SV=2
15	Q9NRA2	5.94e-120	365	495	0.344	0.404	S17A5_HUMAN Sialin OS=Homo sapiens OX=9606 GN=SLC17A5 PE=1 SV=2
16	Q8BN82	6.76e-120	365	495	0.345	0.406	S17A5_MOUSE Sialin OS=Mus musculus OX=10090 GN=Slc17a5 PE=1 SV=2
17	B2RE38	3.12e-119	363	495	0.340	0.400	B2RE38_HUMAN cDNA, FLJ96906, highly similar to Homo sapiens solute carrier family 17 (anion/sugar transporter), member 5 (SLC17A5), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
18	Q5Q0U0	3.55e-119	363	495	0.342	0.402	S17A5_RAT Sialin OS=Rattus norvegicus OX=10116 GN=Slc17a5 PE=1 SV=1
19	Q23514	1.20e-103	323	479	0.296	0.359	Q23514_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slc-17.1 PE=4 SV=3
20	Q2PJ91	1.77e-102	320	474	0.289	0.354	Q2PJ91_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slc-17.1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03092 BT1	71	13.1	BT1 family
2	PF07690 MFS_1	4.5e-46	169.0	Major Facilitator Superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021666

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007791	0.940	Solute carrier family 32 (GABA vesicular transporter), member 1
2	61853.ENSNLEP00000020125	0.926	Solute carrier family 18 (vesicular monoamine transporter), member 2
3	61853.ENSNLEP00000006254	0.885	Solute carrier family 17 (vesicular glutamate transporter), member 7
4	61853.ENSNLEP00000001030	0.854	Solute carrier family 18 (vesicular monoamine transporter), member 1
5	61853.ENSNLEP00000007379	0.809	Solute carrier family 17 (vesicular glutamate transporter), member 8
6	61853.ENSNLEP00000020425	0.773	Glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa)
7	61853.ENSNLEP00000006086	0.722	Synaptotagmin I
8	61853.ENSNLEP00000006345	0.717	Glutamate decarboxylase 1 (brain, 67kDa)
9	61853.ENSNLEP00000011985	0.692	Vesicle-associated membrane protein 2 (synaptobrevin 2)
10	61853.ENSNLEP00000009746	0.664	Discs, large homolog 4 (Drosophila)
11	61853.ENSNLEP00000017581	0.639	Synaptosomal-associated protein, 25kDa
12	61853.ENSNLEP00000007190	0.635	RAB3A, member RAS oncogene family
13	61853.ENSNLEP00000003126	0.616	RAB3C, member RAS oncogene family
14	61853.ENSNLEP00000021986	0.607	Synaptotagmin II
15	61853.ENSNLEP00000009790	0.584	Synaptophysin
16	61853.ENSNLEP00000002791	0.574	Calbindin 1, 28kDa
17	61853.ENSNLEP00000017862	0.574	Parvalbumin
18	61853.ENSNLEP00000000174	0.565	RNA binding protein, fox-1 homolog (C. elegans) 3
19	61853.ENSNLEP00000010118	0.558	LY6/PLAUR domain containing 1
20	61853.ENSNLEP00000019687	0.553	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005313	0.999	L-glutamate transmembrane transporter activity
GO:0005436	0.999	sodium:phosphate symporter activity
GO:0015292	0.515	uniporter activity
GO:0140788	0.510	L-glutamate uniporter activity
GO:0005488	0.464	binding
GO:0005515	0.444	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006836	0.988	neurotransmitter transport
GO:0042886	0.986	amide transport
GO:0006865	0.986	amino acid transport
GO:0009987	0.984	cellular process
GO:0006835	0.977	dicarboxylic acid transport
GO:0015800	0.972	acidic amino acid transport
GO:0015807	0.970	L-amino acid transport
GO:0006817	0.965	phosphate ion transport
GO:0051938	0.959	L-glutamate import
GO:0032501	0.956	multicellular organismal process
GO:0055085	0.914	transmembrane transport
GO:0065007	0.907	biological regulation
GO:0050789	0.814	regulation of biological process
GO:0099003	0.781	vesicle-mediated transport in synapse
GO:0099504	0.748	synaptic vesicle cycle
GO:0050794	0.728	regulation of cellular process
GO:1902475	0.727	L-alpha-amino acid transmembrane transport
GO:0007154	0.721	cell communication
GO:0055062	0.721	phosphate ion homeostasis
GO:0015813	0.714	L-glutamate transmembrane transport
GO:0023052	0.708	signaling
GO:0032502	0.565	developmental process
GO:0048856	0.562	anatomical structure development
GO:0050896	0.556	response to stimulus
GO:0007275	0.550	multicellular organism development
GO:0048731	0.422	system development
GO:0099537	0.346	trans-synaptic signaling
GO:0098916	0.325	anterograde trans-synaptic signaling
GO:0007268	0.324	chemical synaptic transmission
GO:0065008	0.310	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	0.999	endomembrane system
GO:0031410	0.998	cytoplasmic vesicle
GO:0030054	0.995	cell junction
GO:0008021	0.988	synaptic vesicle
GO:0031090	0.962	organelle membrane
GO:0071944	0.948	cell periphery
GO:0005886	0.943	plasma membrane
GO:0098588	0.909	bounding membrane of organelle
GO:0030659	0.901	cytoplasmic vesicle membrane
GO:0030658	0.854	transport vesicle membrane
GO:0030672	0.805	synaptic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.999	Na(+)(in) = Na(+)(out)
RHEA:66336	0.999	L-glutamate(out) = L-glutamate(in)

[back to server]